Share to: share facebook share twitter share wa share telegram print page

TCTN3

TCTN3
Identifikatori
AliasiTCTN3
Vanjski ID-jeviOMIM: 613847 MGI: 1914840 HomoloGene: 9221 GeneCards: TCTN3
Lokacija gena (čovjek)
Hromosom 10 (čovjek)
Hrom.Hromosom 10 (čovjek)[1]
Hromosom 10 (čovjek)
Genomska lokacija za TCTN3
Genomska lokacija za TCTN3
Bend10q24.1Početak95,659,823 bp[1]
Kraj95,694,143 bp[1]
Lokacija gena (miš)
Hromosom 19 (miš)
Hrom.Hromosom 19 (miš)[2]
Hromosom 19 (miš)
Genomska lokacija za TCTN3
Genomska lokacija za TCTN3
Bend19|19 C3Početak40,584,890 bp[2]
Kraj40,600,677 bp[2]
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001143973
NM_015631

NM_026260
NM_001365072

RefSeq (bjelančevina)

NP_001137445
NP_056446

NP_080536
NP_001352001

Lokacija (UCSC)Chr 10: 95.66 – 95.69 MbChr 19: 40.58 – 40.6 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Član 3 porodice tektonskih proteina je protein koji je kod ljudi kodiran genom TCTN3.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 607 aminokiselina, а molekulska težina 66.157 Da.[6]

1020304050
MRTPQLALLQVFFLVFPDGVRPQPSSSPSGAVPTSLELQRGTDGGTLQSP
SEATATRPAVPGLPTVVPTLVTPSAPGNRTVDLFPVLPICVCDLTPGACD
INCCCDRDCYLLHPRTVFSFCLPGSVRSSSWVCVDNSVIFRSNSPFPSRV
FMDSNGIRQFCVHVNNSNLNYFQKLQKVNATNFQALAAEFGGESFTSTFQ
TQSPPSFYRAGDPILTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLES
KSTTCTRFFKNLASSCTLDSALNAASYYNFTVLKVPRSMTDPQNMEFQVP
VILTSQANAPLLAGNTCQNVVSQVTYEIETNGTFGIQKVSVSLGQTNLTV
EPGASLQQHFILRFRAFQQSTAASLTSPRSGNPGYIVGKPLLALTDDISY
SMTLLQSQGNGSCSVKRHEVQFGVNAISGCKLRLKKADCSHLQQEIYQTL
HGRPRPEYVAIFGNADPAQKGGWTRILNRHCSISAINCTSCCLIPVSLEI
QVLWAYVGLLSNPQAHVSGVRFLYQCQSIQDSQQVTEVSLTTLVNFVDIT
QKPQPPRGQPKMDWKWPFDFFPFKVAFSRGVFSQKCSVSPILILCLLLLG
VLNLETM

Funkcija

Ovaj gen kodira člana porodice tektonskih gena koji funkcionira u transdukciji ježnih signala i razvoju nervne cijevi. Mutacije u ovom genu povezane su s Oralno-facijalno-digitalnim sindromom IV i Joubertovim sindromom 18. Za ovaj gen primijećene su alternativno prerađene varijante transkripta koje kodiraju više izoformi (obezbijedio RefSeq, Sep 2012).

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000119977 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000025008 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Tectonic family member 3". Pristupljeno 22. 12. 2012.
  6. ^ "UniProt, Q6NUS6". Pristupljeno 5. 9. 2021.

Read other articles:

Outdoor National Hockey League game 2018 NHL Winter Classic 123OT Total New York Rangers 2001 3 Buffalo Sabres 0110 2 DateJanuary 1, 2018VenueCiti FieldCityQueens, New YorkAttendance41,821 ← 2017 2019 → The 2018 NHL Winter Classic (officially the 2018 Bridgestone NHL Winter Classic) was an outdoor ice hockey game played in the National Hockey League (NHL) on January 1, 2018, at Citi Field in the New York City borough of Queens. The tenth edition of the Winter Classic, th...

 

2002 studio album by KHMGameStudio album by KHMReleasedNovember 19, 2002Recorded2002StudioThe Crack House West (Hollywood, CA)The Flower Shop (Hollywood, CA)The Silent Sound Studios (Hollywood, CA)GenreUnderground hip hopLength53:26LabelNumber 6 RecordsProducerDarrick Angelone (exec.)Marc Live (also exec.)Kool Keith (also exec.)H-Bomb aka Jacky Jasper (also exec.)KHM/Clayborne Family chronology Game(2002) Clayborne Family(2004) Kool Keith chronology Spankmaster(2001) Game(2002) Kool K...

 

2017 Japanese animated film by Risako Yoshida The Irregular at Magic High School: The Movie – The Girl Who Summons the StarsTheatrical release posterKanji劇場版 魔法科高校の劣等生 星を呼ぶ少女Revised HepburnGekijōban Mahōka Kōkō no Rettōsei: Hoshi o Yobu Shōjo Directed byRisako YoshidaScreenplay by Tsutomu Satō Muneo Nakamoto Story byTsutomu SatōBased onThe Irregular at Magic High Schoolby Tsutomu SatōProduced by Shinichiro Kashiwada Kazuma Miki Yasutaka Kimura Ko...

De stad Parijs telt vele begraafplaatsen, waarvan de beroemdste het Cimetière du Père-Lachaise is, omwille van alle bekende personen die er begraven liggen. Met naar schatting twee miljoen bezoekers per jaar, waarschijnlijk de meest bezochte begraafplaats ter wereld. De andere begraafplaatsen zijn vaak ook een bezoek waard, zowel voor de grafmonumenten als de bekende bewoners. Zie ook: Lijst van Parijse bezienswaardigheden Begraafplaatsen in Parijs (intra muros) Cimetière d'Auteuil (16e ar...

 

عنتجبال سوريامحافظة السويداء جبل حوران محافظة درعا جبل غباغب محافظة القنيطرة جبل الشيخ • تل الفرس • تل أبو الندى • تل العرام • تل الغسانية • تل يوسف • تل الجوخدار • تل الشحم دمشق وريفها جبل قاسيون (جبل الأربعين) • جبال القلمون جبل المضيع • جبال ل�...

 

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (سبتمبر 2020) هذه المقالة تحتاج للمزيد من الوصلات للمقالات الأخرى للمساعدة في ترابط مقالات الموسوعة. فضلًا ساعد في تحسين هذه المقالة بإضافة وصلات إلى المقالات المتعلقة �...

Darlingtonia californica is a carnivorous plant, the sole member of the genus Darlingtonia in the family Sarraceniaceae. This list of carnivorous plants is a comprehensive listing of all known carnivorous plant species, of which more than 750 are currently recognised.[1] Unless otherwise stated it is based on Jan Schlauer's Carnivorous Plant Database. Extinct taxa are denoted with a dagger (†). Some of the species on this list may not satisfy certain strict definitions of plant carn...

 

Main tool used to implement the kanban project management methodology A kanban board A kanban board is one of the tools that can be used to implement kanban to manage work at a personal or organizational level. Kanban boards visually depict work at various stages of a process using cards to represent work items and columns to represent each stage of the process. Cards are moved from left to right to show progress and to help coordinate teams performing the work. A kanban board may be divided ...

 

Paramilitary group which plotted bombings around the state This article is an orphan, as no other articles link to it. Please introduce links to this page from related articles; try the Find link tool for suggestions. (February 2022) Georgia Republic MilitiaLeaderFrank SmithRobert StarrDates of operation1995-27 April 1996Active regionsGeorgia, United StatesIdeologyChristian nationalismConservatismNationalist conservatismLibertarianismRight-wingSovereign citizen movementSocial conservatis...

Form of tax This article is part of a series onTaxation in the United States Federal taxation Alternative minimum tax Capital gains tax Corporate tax Estate tax Excise tax Gift tax Generation-skipping transfer tax Income tax Payroll tax Internal Revenue Service (IRS) Internal Revenue Code (IRC) IRS tax forms Revenue by state History Constitutional authority Taxpayer standing Court Protest Evasion Resistance State and local taxation State income tax Property tax Sales tax State and local tax d...

 

Cal Poly Humboldt LumberjacksUniversityCalifornia State Polytechnic University, HumboldtConferenceCCAA (primary)GNAC (rowing)NCAADivision IIAthletic directorNick PettitLocationArcata, CaliforniaVarsity teams12 (4 men's, 8 women's)Football stadiumRedwood BowlBasketball arenaLumberjack ArenaSoftball stadiumHumboldt Softball FieldSoccer stadiumCollege Creek Soccer FieldNicknameLumberjacksWebsitehumboldtathletics.com The Cal Poly Humboldt Lumberjacks are the 12 varsity athletic teams that represe...

 

Map

Symbolic depiction of relationships For other uses, see Map (disambiguation) and Maps (disambiguation). This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (July 2017) (Learn how and when to remove this template message) World map by Gerard van Schagen, Amsterdam, 1689 World map from CIA World Factbook, 2016 A map is a symbolic depiction emphasizing relationships ...

artikel ini tidak memiliki pranala ke artikel lain. Tidak ada alasan yang diberikan. Bantu kami untuk mengembangkannya dengan memberikan pranala ke artikel lain secukupnya. (Pelajari cara dan kapan saatnya untuk menghapus pesan templat ini) Artikel ini sebatang kara, artinya tidak ada artikel lain yang memiliki pranala balik ke halaman ini.Bantulah menambah pranala ke artikel ini dari artikel yang berhubungan atau coba peralatan pencari pranala.Tag ini diberikan pada Januari 2023. artikel ini...

 

Auguste Scheurer-Kestner Auguste Scheurer-Kestner (11 February 1833 in Mulhouse (Haut Rhin)[1] – 19 September 1899 in Bagnères-de-Luchon (Haute Garonne)) was a chemist, industrialist, a Protestant and an Alsatian politician. He was the uncle by marriage of the wife of Jules Ferry.[2] He was a Republican and opposed the Empire of Napoleon III. He was elected member for Haut Rhin on 2 July 1871 and became senator for life on 15 September 1875. Twenty years later, he was t...

 

Бронислав Брониславович Виногродский Дата рождения 19 апреля 1957(1957-04-19) (66 лет) Место рождения Хурмули, Комсомольский район, Хабаровский край, СССР Страна  СССР Россия Научная сфера китайская философия Альма-матер ДВГУ (1979) Сайт bronislav.ru (рус.) Бронисла́в Бронисла́вов...

Disused railway station in Kent, England GrainThe site of the station in 1995General informationLocationGrain, MedwayEnglandGrid referenceTQ869750Platforms2Other informationStatusDisusedHistoryPost-groupingBritish Railways, Southern RegionKey dates3 September 1951Opened4 December 1961Closed Grain station (TQ 869 750 51°26′38″N 0°41′04″E / 51.443833°N 0.684335°E / 51.443833; 0.684335) was a railway station in the Medway, England. It opened on 3 September 195...

 

Koordinator Staf Ahli KasadLambang TNI Angkatan DaratBendera Jabatan Koordinator Staf Ahli KasadPetahanaLetnan Jenderal TNI Sonny Apriantosejak 9 November 2023Situs webwww.tniad.mil.id Staf Ahli Kepala Staf Angkatan Darat (Sahli Kasad) adalah pembantu Kepala Staf Angkatan Darat dalam memberikan telaahan secara akademis masalah nasional dan internasional yang terkait dan mendukung tugas-tugas TNI AD, serta disusun secara konsepsional, sebagai saran untuk membantu Kasad dalam menentukan ke...

 

1966 film by Cornel Wilde This article is about the 1965 film. For other uses, see Naked Prey (disambiguation). The Naked PreyTheatrical release posterDirected byCornel WildeWritten byClint JohnstonDon PetersProduced byCornel WildeSven PerssonStarring Cornel Wilde Ken Gampu Patrick Mynhardt Bella Randels Gert van den Bergh Distributed byParamount PicturesRelease dates June 3, 1965 (1965-06-03) (San Sebastián Film Festival) March 23, 1966 (1966-03-23) (Un...

Generator beralih ke halaman ini. Untuk kegunaan lain, lihat Generator (disambiguasi). Generator abad 20 awal Generator listrik atau pembangkit listrik adalah mesin yang digunakan untuk menghasilkan energi listrik dari sumber energi mekanis. Prinsip kerja dari generator listrik adalah induksi elektromagnetik.[1] Berdasarkan jenis arus listriknya, generator dibagi menjadi generator arus searah dan generator arus bolak-balik. Perbedaan keduanya yaitu penggunaan komutator pada generator ...

 

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: The Fittest of the Fittest – news · newspapers · books · scholar · JSTOR (June 2023) (Learn how and when to remove this template message) 1983 studio album by Burning SpearThe Fittest of the FittestStudio album by Burning SpearReleased1983Recorded1983Ge...

 
Kembali kehalaman sebelumnya