Read other articles:
American actor For the soccer player, see Derek Luke (soccer). Derek LukeLuke at Orlando, Florida in 2013BornDerek Nathanial Luke (1974-04-24) April 24, 1974 (age 49)Jersey City, New Jersey, U.S.OccupationActorYears active1999–presentSpouse Sophia Adella Luke (m. 1998)Children1 Derek Nathanial Luke (born April 24, 1974)[1] is an American actor. He won the Independent Spirit Award for his big-screen debut performance as the titular character i...
Keuskupan Gap dan EmbrunDioecesis Vapincensis et EbrodunensisDiocèse de Gap et d'EmbrunKatolik Katedral Gap (dibangun pada 1866–1905)LokasiNegara PrancisProvinsi gerejawiMarseilleStatistikLuas5.643 km2 (2.179 sq mi)Populasi- Total- Katolik(per 2013)141.500121,300 (85.7%)InformasiDenominasiKatolik RomaGereja sui iurisGereja LatinRitusRitus RomaPendirianAbad ke-5KatedralKatedral Notre-Dame dan Santo Arnoux di GapKepemimpinan kiniPausFransiskusUskupXave...
Частина інформації в цій статті застаріла. Ви можете допомогти, оновивши її. Можливо, сторінка обговорення містить зауваження щодо потрібних змін. (серпень 2023) Бригіда Фроштенга-КмецикНародилася 25 січня 1981(1981-01-25)Лендзіни, Берунсько-Лендзінський повіт, Сілезьке воєвод�...
Japanese anime television series Battle Girls: Time ParadoxCover of the first DVD volume戦国乙女～桃色パラドックス～(Sengoku Otome ~Momoiro Paradokkusu~) Anime television seriesDirected byHideki OkamotoWritten byTouko MachidaMusic byEishi SegawaStudioTMS EntertainmentLicensed byNA: Sentai FilmworksUK: MVM FilmsOriginal networkTV TokyoOriginal run April 5, 2011 – June 27, 2011Episodes13 GameSengoku Otome: Battle LegendDeveloperShirogumi NMDGenreActionPlatfor...
Drifters - Save the Last Dance for Me (1960) Save the Last Dance for Me ist ein US-amerikanischer Popsong und Evergreen, der von Doc Pomus und Mort Shuman geschrieben wurde. Das Stück wurde 1960 mit den Drifters ein Nummer-eins-Hit in den Vereinigten Staaten. 1961 belegte Ivo Robić mit der Coverversion Mit 17 fängt das Leben erst an den ersten Platz in Deutschland. Inhaltsverzeichnis 1 Entstehungsgeschichte 2 Veröffentlichung und Erfolg 3 Coverversionen 4 Literatur 5 Weblinks 6 Einzelnach...
هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (نوفمبر 2018) آن جانسون معلومات شخصية الميلاد 6 مايو 1957 (66 سنة) ستوكهولم مركز اللعب لاعبة وسط الجنسية السويد مسيرة الشباب سنوات فريق Karlbergs BK [الإنجليزية...
Media franchise This article is about the franchise. For the 1983 series, see Inspector Gadget (1983 TV series). For the film, see Inspector Gadget (film). For the video game, see Inspector Gadget (video game). For other uses, see Inspector Gadget (disambiguation). Inspector GadgetCreated byBruno BianchiAndy HeywardJean ChalopinOriginal workInspector GadgetOwnerWildBrainDisney (film rights)[1][2]Years1983–presentPrint publicationsComicsInspector GadgetFilms and televisionFil...
Nicolas Claxton Informações pessoais Nome completo Nicolas Devir Claxton Data de nasc. 17 de abril de 1999 (24 anos) Local de nasc. Greenville, Carolina do Sul, Estados Unidos Altura 6 ft 11 in (2.11 m) Peso 215 lb (98 kg) Apelido The Slim Reaper The Alchemist Informações no clube Clube atual Brooklyn Nets Número 33 Posição Pivô Clubes de juventude 2017–2019 Georgia Bulldogs Clubes profissionais Ano Clubes Partidas (pontos) 2019–Presente 2019–2020 Brooklyn Nets → Lon...
?Морський тарган солонуватоводний Біологічна класифікація Царство: Тварини (Animalia) Тип: Членистоногі (Arthropoda) Підтип: Ракоподібні (Crustacea) Клас: Вищі ракоподібні (Malacostraca) Ряд: Рівноногі (Isopoda) Підряд: Valvifera Родина: Chaetiliidae Рід: Морський тарган (Saduria) Вид: Морський тарган солонуват�...
American Methodist seminary Not to be confused with Asbury University. Asbury Theological SeminaryMottoThe whole Bible for the whole world.TypeSeminaryEstablished1923; 100 years ago (1923)Endowment$149.9 million (2020)[1]PresidentTimothy C. TennentStudents1,710LocationWilmore, Kentucky, United StatesCampusExurban (Kentucky), Suburban (Florida), OnlineWebsitewww.asburyseminary.edu Asbury Theological Seminary is a Christian Wesleyan seminary in the historical Methodist...
Cet article est une ébauche concernant la littérature française et l’historiographie. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Vue de Delphes et des deux roches du Parnasse-Essai sur les environs de Delphes, pour le Voyage du jeune Anacharsis par Jean-Jacques Barthélemy, 1832. Le Voyage du jeune Anacharsis en Grèce, dans le milieu du quatrième siècle avant l'ère vulgaire est un récit de voyage d...
Der erste Kindergarten der USA Der erste Kindergarten (First Kindergarten) in Watertown, Wisconsin, ist der erste in den USA gegründete Kindergarten. Geschichte Im Haus 919 Charles Street in Watertown wurde 1856 der erste Kindergarten der Vereinigten Staaten von Amerika eröffnet.[1] In ihrem Wohnhaus betreute Margarethe Schurz anfangs ihre eigene Tochter und vier Neffen und Nichten.[2][3][4] Als weitere Kinder hinzukamen, eröffnete sie eine Schule im Haus. 1...
Auto Union Typ A/B/C/D Общие данные Производитель Auto Union, Horch Годы производства 1933—1939 Сборка Цвиккау, Германия. Класс Гран-при Дизайн и конструкция Тип кузова гоночный болид Компоновка задняя среднемоторная, заднеприводная Колёсная формула 4 × 2 Двигатель V12 / V16 Трансмиссия М...
For the district, see Mansehra District. For other uses, see Mansehra (disambiguation). City in Khyber Pakhtunkhwa, PakistanMansehra مانسهرهمانسہرہCityMansehra after winter snowfallCoordinates: 34°20′2″N 73°12′5″E / 34.33389°N 73.20139°E / 34.33389; 73.20139Country PakistanProvince Khyber PakhtunkhwaDistrictMansehraTehsilMansehraRegionUpper PakhliArea[1] • Total1,340 km2 (520 sq mi)Elevation1,088...
Genus of carnivores Mephitis Hooded skunk (M. macroura) and striped skunk (M. mephitis) Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Mammalia Order: Carnivora Family: Mephitidae Genus: MephitisÉ. Geoffroy Saint-Hilaire & G. Cuvier, 1795 Type species Viverra mephitisSchreber, 1776 Species Mephitis mephitis Mephitis macroura Mephitis ranges Mephitis is one of several genera of skunks and comprises two species, both of which are found in North Americ...
Indian dynasty (c. 225 – c.340) For other uses, see Ikshvaku (disambiguation). Ikshvakus of VijayapuriEarly 3rd century–early 4th centurySouth Asia350 CEYAUDHEYASARJUNAYANASMADRAKASMALAVASIKSHVAKUSKALABHRASWESTERNGANGASTOCHARIANSKADAMBASPALLAVASLITTLEKUSHANSLICCHAVISWESTERNSATRAPSSASANIANHINDMAHAMEGHA-VAHANASKAMARUPAGAUDASAMATATASDAVAKAKIDARITESABHIRASVAKATAKASGUPTAEMPIREKUSHANO-SASANIANSSAKASTANTURANMAKRANSASANIANEMPIRE ◁ ▷ Location of the Andhra Ikshvakus in c. 350 CECapitalVi...
2022 Philippine television series Little PrincessTitle cardGenreDramaDirected by L.A. Madridejos Don Michael Perez StarringJo BerryOpening themeKung Mayroong Dahilan by Shanicka ArgandaCountry of originPhilippinesOriginal languageTagalogNo. of episodes73ProductionExecutive producerArlene Del Rosario-PilapilCamera setupMultiple-camera setupProduction companyGMA Entertainment GroupOriginal releaseNetworkGMA NetworkReleaseJanuary 10 (2022-01-10) –April 22, 2022 (2022-04-22) Litt...
Swedish actress (1948–2021) You can help expand this article with text translated from the corresponding article in Swedish. (June 2021) Click [show] for important translation instructions. Machine translation, like DeepL or Google Translate, is a useful starting point for translations, but translators must revise errors as necessary and confirm that the translation is accurate, rather than simply copy-pasting machine-translated text into the English Wikipedia. Do not translate text th...
First edition (publ. Viking Press) Hitler's Scientists is a book by John Cornwell[1][2] describing scientific life in Germany in the buildup to, during, and after World War II. Detailed is the discrimination and persecution of scientists' groups marginalized by Nazi Germany—such as the Jews, the failed development of a nuclear weapon, the development of rocket technology, and the human experiments performed during World War II. The Guardian review called the book a timely an...
Television series based on the reality show Survivor This article is about the Australian edition of Survivor. For the second season of the American edition set in Australia, see Survivor: The Australian Outback. For the most recent season, see Australian Survivor: Heroes V Villains. Australian SurvivorGenreReality competitionCreated byCharlie ParsonsBased onExpedition Robinson/Survivorby Charlie ParsonsPresented by Lincoln Howes Ian Dicko Dickson Jonathan LaPaglia StarringAustralian Survivor...