Read other articles:

Alexander Chigogidze (Georgian: ალექსანდრე ჩიგოგიძე; 1 January 1955 – 14 December 2014)[1] was a Georgian-born general topologist. Chigogidze is best known for his book Inverse Spectra,[2] in which he passed on to the next generation of topologists the results of the Fedorchuk -Schepin Topology seminars held at the Moscow State University during the 1980s. The book also contains important contributions Chigogidze made in the area of Genera...

Село Нове Реськопол. Nowe Resko Координати 53°41′51″ пн. ш. 15°57′50″ сх. д. / 53.69777222224977464° пн. ш. 15.96403611113877830° сх. д. / 53.69777222224977464; 15.96403611113877830Координати: 53°41′51″ пн. ш. 15°57′50″ сх. д. / 53.69777222224977464° пн. ш. 15.96403611113877830° сх. д.࿯...

NephthysNephthys digambarkan sebagai perempuan muda, mengenakan mahkota berbentuk rumah dan keranjangDewi Perkabungan dan RatapanNama dalam hiroglif Pusat pemujaantidak ada secara khusus, Diospolis ParvaSimbolrumah, pembungkus mumiOrangtuaGeb dan NutSaudaraIsis, Osiris, Horus, dan SetPasanganSet Nephthys - Musée du Louvre, Paris, France Nephthys Hieroglif Mesir Dalam mitologi Mesir, Nephthys adalah bentuk Yunani dari epitet (sebenarnya dibaca Nebet-het, dan Nebt-het, dalam transliterasi dari...

NGC 2207 / IC 2163Foto Teleskop Luar Angkasa Hubble NGC 2207 dan IC 2163.Credit: HST/NASA/ESA.Data pengamatan (J2000 epos)Rasi bintangCanis MajorAsensio rekta 06j 16m 22.0d /  06j 16m 28.0d[1]Deklinasi -21° 22′ 22″ /  -21° 22′ 33″[1]Pergeseran merah2741 ± 15 / 2765 ± 20 km/s[1]Jarak81 ± 39 Mly(24.9 ± 12 Mpc)[2]Magnitudo semu (V)12.2 / 11.6[1]Ciri-ciriJenisSAB(rs)bc pec / SB(r...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أبريل 2019) ألفرد ر. خان معلومات شخصية الميلاد 18 يناير 1947 (76 سنة)[1]  بروكلين  مواطنة الولايات المتحدة  الحياة العملية المدرسة الأم جامعة لونغ أيلاند  المهنة...

Mahdi Sohrabi Mehdi-Sohrabi Persoonlijke informatie Geboortedatum 12 oktober 1981 Geboorteplaats Zanjan, Iran Sportieve informatie Discipline(s) Weg Ploegen 20052007–200820092009–201120122013–2015 20162017–2018 PaykanIslamic Azad UnivercityAzad University IranTabriz Petrochemical TeamLotto-BelisolTabriz Petrochemical Team Tabriz Sherdari TeamPishgaman Cycling Team Portaal    Wielersport Mahdi Sohrabi (Perzisch: مهدی سهرابی; Zanjan, 12 oktober 1981) is een Iraans pr...

2004 Bahrain Grand Prix Race 3 of 18 in the 2004 Formula One World Championship Race detailsDate 4 April 2004Official name 2004 Gulf Air Bahrain Grand PrixLocation Bahrain International Circuit, Sakhir, BahrainCourse Permanent racing facilityCourse length 5.417 km (3.366 miles)Distance 57 laps, 308.523 km (191.860 miles)Weather Warm, dry and overcastAttendance 68,000 (Weekend) [1]Pole positionDriver Michael Schumacher FerrariTime 1:30.139Fastest lapDriver Michael Schumacher FerrariTim...

Fictional character from American soap opera All My Children Soap opera character Kendall HartAll My Children characterAlicia Minshew as Kendall HartPortrayed by Sarah Michelle Gellar (1993–1995) Alicia Minshew (2002–2013) Duration 1993–1995 2002–2011 2013 First appearanceFebruary 24, 1993Last appearanceJuly 8, 2013ClassificationFormer: regularCreated byMegan McTavishIntroduced byFelicia Minei Behr (1993)Jean Dadario Burke (2002)Ginger Smith (2013)Crossoverapp...

He ZizhenLahir1910Yunshan, Jiangxi, Kekaisaran QingMeninggal1984 – 1910; umur -75–-74 tahunShanghai, TiongkokPartai politikPartai Komunis TiongkokSuami/istriMao ZedongAnakYang Yuehua (l. 1929)Putra keempat (l. 1930)Mao Anhong (l. 1932)Putri kedua (l. 1935)Li Min (l. 1936)Putra keenam (l. 1938) Ini adalah nama Tionghoa; marganya adalah He. He Zizhen Hanzi tradisional: 賀子珍 Hanzi sederhana: 贺子珍 Alih aksara Mandarin - Hanyu Pinyin: Hè Zǐzhēn - Wade-Giles: He Tzu-ch...

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

1936 novel by Rex Stout The Rubber Band AuthorRex StoutCover artistWinifred E. LeffertsCountryUnited StatesLanguageEnglishSeriesNero WolfeGenreDetective fictionPublisherFarrar & RinehartPublication dateApril 9, 1936Media typePrint (Hardcover)Pages308 pp. (first edition)OCLC4962869Preceded byThe League of Frightened Men Followed byThe Red Box  The Rubber Band is the third Nero Wolfe detective novel by Rex Stout. Prior to its publication in 1936 by Farrar &...

King of Assyria Ashur-nirari IVKing of AssyriaKing of the Middle Assyrian EmpireReign1019–1013 BCPredecessorShalmaneser IISuccessorAshur-rabi IIFatherShalmaneser IIAššur-nērārī IV, inscribed maš-šur-ERIM.GABA, (the god) Aššur is my help,[1] was the king of Assyria, the 94th to appear on the Assyrian Kinglist,[i 1][i 2] ruling 1019/18–1013 BC. His short six-year reign was marked by confusion and a dearth of contemporary inscriptions. Biography Schroeder's l...

Universitas Muhammadiyah Sumatera BaratJenisPerguruan tinggi swastaDidirikan18 November 1955 (sebagai Fakultas Falsafah dan Hukum Padang Panjang)13 Maret 1985 (sebagai Universitas)AfiliasiMuhammadiyahRektorDr. Riki Saputra, M.A.LokasiPadang, Padangpanjang, Bukittinggi, Payakumbuh, Sumatera Barat, IndonesiaWarnaMerahNama julukanUMSB, UM Sumatera BaratSitus webumsb.ac.id Universitas Muhammadiyah Sumatera Barat adalah salah satu universitas swasta tertua di Sumatera Barat yang telah berdiri seja...

Independent Dutch research institute tasked with measuring and forecasting the economy Headquarters at Bezuidenhoutseweg 30 in The Hague The Netherlands Bureau for Economic Policy Analysis (Dutch: Centraal Planbureau, CPB, literal translation: Central Planning Bureau) is a part of the Ministry of Economic Affairs and Climate Policy of the Netherlands. Its goal is to deliver economic analyses and forecasts. The CPB is an independent government agency founded at 15 September 1945 by Nobel laure...

This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) The topic of this article may not meet Wikipedia's notability guidelines for companies and organizations. Please help to demonstrate the notability of the topic by citing reliable secondary sources that are independent of the topic and provide significant coverage of it beyond a mere trivial mention. If notability cannot be shown, the articl...

2021 World Women's Curling ChampionshipHost cityCalgary, Alberta, CanadaArenaMarkin MacPhail Centre, Canada Olympic ParkDates30 April–9 May 2021Attendance0 (behind closed doors)Winner  SwitzerlandCurling clubCC Aarau, Aarau & Bern CC, BernSkipSilvana TirinzoniFourthAlina PätzSecondEsther NeuenschwanderLeadMelanie BarbezatAlternateCarole HowaldCoachPierre CharetteFinalist RCF (Kovaleva)« 2020 (cancelled) 2022 » The 2021 World Women's Curling Championship (branded a...

MVV Maastricht — Seizoen 2003/04 Naam Maatschappelijke Voetbal Vereniging Maastricht Bijnaam Us MVV'keDe Sterrendragers Opgericht 2 april 1902 Plaats Maastricht Stadion Geusselt Capaciteit 10.500 Complex Klein Geusselt Voorzitter Joseph Goumans Trainer Jan van Deinsen Rob Delahaye Assistent Rob Delahaye Andries Jonker Topscorer(s) Fabio Caracciolo (11) Competitie Eerste divisie Tenue Geldig voor 2003-2004 Chronologie ← Vorige Volgende → 2002/03 2004/05 Portaal    Voetbal Het s...

2007 book by Chris Elliott Into Hot Air First US edition coverAuthorChris ElliottPublisherWeinstein CompanyPages352 (US hardback)ISBN1-60286-007-6OCLC154694540Dewey Decimal813/.6 22LC ClassPS3605.L4453 I58 2007 Into Hot Air is a 2007 book written by American comedian and author Chris Elliott, and published by the Weinstein Company in the United States. The book is a parody of celebrity and adventure memoirs.[1] Its title references Jon Krakauer's 1996 Into Thin Air, a memoir of a...

Artikel ini sebatang kara, artinya tidak ada artikel lain yang memiliki pranala balik ke halaman ini.Bantulah menambah pranala ke artikel ini dari artikel yang berhubungan atau coba peralatan pencari pranala.Tag ini diberikan pada November 2022. The First KissKartu lobiSutradara Rowland V. Lee Produser B. P. Schulberg Rowland V. Lee Adolph Zukor Jesse Lasky Ditulis olehJohn Farrow Tom ReedBerdasarkanFour Brothersoleh Tristram TupperPemeran Fay Wray Gary Cooper SinematograferAlfred GilksPenyun...

Terri TatchellTatchell pada Oktober 2009Lahir01 Januari 1978 (umur 45)Toronto, KanadaPekerjaanPenulis naskah, penulis anak-anakTahun aktif2006–sekarangSuami/istriNeill BlomkampAnak1Situs webhttps://endangeredandmisunderstood.com Terri Tatchell (lahir 1 Januari 1978) adalah seorang penulis naskah Kanada. Ia dikenal karena menjadi salah satu penulis skenario District 9[1] dan dinominasikan untuk Skenario Adaptasi Terbaik di Academy Awards ke-82.[2] Filmografi Adicolo...