Share to: share facebook share twitter share wa share telegram print page

Cheryl Hines

Cheryl Hines al Tribeca Film Festival 2009

Cheryl Hines (Miami Beach, 21 settembre 1965) è un'attrice statunitense.

Biografia

Ha studiato presso la Florida State University e l'University of Central Florida, in seguito ha iniziato la sua carriera artistica lavorando come assistente personale del regista Rob Reiner. Nel corso degli anni è apparsa nelle commedie ...e alla fine arriva Polly, Herbie - Il super Maggiolino, Vita da camper, Al passo con gli Stein e La dura verità.

L'attrice è nota negli Stati Uniti soprattutto per la sua partecipazione alla sit-com Curb Your Enthusiasm, serie trasmessa in Italia dal canale satellitare Jimmy. Nel 2008 ha recitato al fianco di Luke Wilson in Henry Poole - Lassù qualcuno ti ama.

Nel 2009 ha debuttato alla regia con la commedia Serious Moonlight, con Meg Ryan e Justin Long, film basato su una sceneggiatura dell'amica scomparsa Adrienne Shelly, dalla quale era stata diretta in Waitress - Ricette d'amore.

Ha recitato nella commedia Incinta o... quasi, insieme a Lindsay Lohan.

Vita privata

Cheryl Hines alla premiazione dei Premi Oscar 2011

La Hines ha sposato nel 2002 il produttore cinematografico Paul Young; i due sono i genitori di Catherine Rose Young, nata nel 2004. La coppia ha divorziato dopo circa otto anni di matrimonio.[1]

Nel 2014 l'attrice ha sposato Robert F. Kennedy Jr., terzo figlio di Robert F. Kennedy e di Ethel Skakel, alla sua terza esperienza matrimoniale.

Filmografia parziale

Cinema

Televisione

Regia

Doppiatrici italiane

Nelle versioni in italiano delle opere in cui ha recitato, Cheryl Hines è stata doppiata da:

Da doppiatrice è sostituita da:

Note

  1. ^ (EN) Curb Your Enthusiasm's Cheryl Hines Getting Divorced, su tvguide.com, TV Guide. URL consultato il 23 agosto 2010.

Altri progetti

Collegamenti esterni

Controllo di autoritàVIAF (EN61859359 · ISNI (EN0000 0001 1655 9392 · LCCN (ENnr2002000952 · GND (DE141089105 · BNE (ESXX4763717 (data) · BNF (FRcb15527872w (data)

Read other articles:

كوين أوف ساوث   تأسس عام 1919  البلد المملكة المتحدة  الدوري دوري كرة القدم الاسكتلندي الدرجة الثانية  [لغات أخرى]‏  المدرب ألان جونستون  الموقع الرسمي الموقع الرسمي  تعديل مصدري - تعديل   نادي كوين أو ساوث لكرة القدم (بالإنجليزية: Queen of the South Football Club)‏ �...

 

Este artículo o sección necesita referencias que aparezcan en una publicación acreditada.Este aviso fue puesto el 2 de agosto de 2010. Julian Cope Julian Cope en vivo en Japón (2006).Información personalNombre de nacimiento Julian David CopeOtros nombres Julian CopeNacimiento 21 de octubre de 1957 (66 años), Deri, Monmouthshire, País de Gales,  Reino UnidoDeri (Reino Unido) Nacionalidad BritánicaEducaciónEducado en Universidad John Moores Información profesionalOcupac...

 

Economy of EthiopiaAddis Ababa, the financial centre of EthiopiaCurrencyBirr (ETB, ብር)Fiscal year7 – 8 JulyTrade organisationsAU, AfCFTA, COMESA, IGAD, WTO (observer), G24Country group Developing/Emerging[1] Low-income economy[2] StatisticsPopulation 124,937,259 (2023)[3]GDP $156.1 billion (nominal, 2023 est.)[4] $393.85 billion (PPP, 2023 est.)[4] GDP rank 63rd (nominal, 2018) 62nd (PPP, 2018) GDP growth 7.7% (2018) 9.0% (2019) 6.1%...

Марго-КантенакMargaux-Cantenac Країна  Франція Регіон Нова Аквітанія  Департамент Жиронда  Округ Леспарр-Медок Код INSEE 33268 Поштові індекси 33460 Координати 45°02′31″ пн. ш. 0°40′32″ зх. д.H G O Висота 1 - 23 м.н.р.м. Площа 21.62 км² Населення 2832 (01-2020[1]) Розміщення Влада [Site o...

 

  هذه المقالة عن محمد بن الحسن القزويني. لمعانٍ أخرى، طالع القزويني (توضيح). رضي القزويني معلومات شخصية الميلاد لم يحدد تاريخ ولادته في المصادر التي ترجمت له.قزوين،  الدولة الصفوية. الوفاة 1096 هـ.[1]قزوين،  الدولة الصفوية. مواطنة إيران  تعديل مصدري - تعديل   �...

 

Chiesa di San Francesco d'AssisiL'esternoStato Italia RegioneCampania LocalitàNapoli Coordinate40°50′24.32″N 14°13′44.18″E / 40.84009°N 14.22894°E40.84009; 14.22894Coordinate: 40°50′24.32″N 14°13′44.18″E / 40.84009°N 14.22894°E40.84009; 14.22894 Religionecattolica di rito romano TitolareFrancesco d'Assisi Arcidiocesi Napoli Stile architettoniconeoromanico Completamento1894 Modifica dati su Wikidata · Manuale L'interno La chie...

Cet article est une ébauche concernant une unité ou formation militaire française. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. 176e régiment d’infanterie Création 21 mars 1915 Pays France Branche Armée de terre Type régiment d'infanterie Rôle infanterie Inscriptionssur l’emblème Dardanelles 1915Florina 1916 Anniversaire Saint-Maurice Décorations Croix de guerre 1914-1918une palme modifier&#...

 

Sebuah pedometerPedometer adalah alat portabel elektronik atau elektromekanik yang menghitung tiap langkah orang dengan mendeteksi gerakan tangan atau pinggul. Karena jarak tempuh orang dapat berbeda, kalibrasi oleh pengguna diperlukan jika jarak yang ditampilkan merupakan satuan panjang seperti kilometer atau mil, meski saat ini pedometer lebih banyak yang elektronik atau berbasis perangkat lunak. Jarak tempuh (berjalan kaki misalnya), dapat diukur dengan penerima GPS. Berawal dari penggunaa...

 

British steamship that sank in 1866 London under way History United Kingdom NameLondon OwnerMoney Wigram and Sons OperatorMoney Wigram and Sons BuilderMoney Wigram and Sons, Blackwall Yard Launched20 July 1864 Out of service11 January 1866 Identification UK official number 50114 code letters WGRT FateSank, 11 January 1866 General characteristics Tonnage1,429 Length276.6 ft (84.3 m) Beam35.9 ft (10.9 m) Draught24.1 ft (7.3 m) Installed power200 nhp PropulsionCompo...

الدستور السويدي لعام 1772معلومات عامةالبداية 21 أغسطس 1772 الاختصاص السويد(1772 – 1809)دوقية فنلندا الكبرى(1809 – 1917)فنلندا(1917 – 1919) حل محله الدستور السويدي لعام 1809(1809)Constitution Act of Finland (en) (1919) حلَّ محل الدستور السويدي لعام 1720 تاريخ الحل أو الإلغاء أو الهدم 180917 يوليو 1919 ألغيت بموجب الدست...

 

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

 

2016 action-adventure video game 2016 video gameSeveredDeveloper(s)DrinkBox StudiosPublisher(s)DrinkBox StudiosPlatform(s)PlayStation Vita, Wii U, Nintendo 3DS, iOS, Nintendo SwitchReleasePlayStation VitaWW: April 26, 2016Wii U, iOSWW: September 22, 2016Nintendo 3DSEU: September 22, 2016NA: October 13, 2016Nintendo SwitchWW: August 8, 2017Genre(s)Action-adventureMode(s)Single-player Severed is an action-adventure video game developed and published by DrinkBox Studios for the PlayStation Vita,...

Australian Standardbred racehorse Smoken UpBreedStandardbredSireTinted CloudGrandsireIn The PocketDamCarnlough BayDamsireCamtasticSexGeldingFoaled7 November 2002CountryAustraliaColorBayBreederSM & CM Dunlop EJ & DW MonkOwnerA P KayP G GadsbyA B BonneyM J Van RensR J KayV MacDonaldL D LocastroTrainerLance JusticeRecord153:74-39-15Earnings$3,607,985Major winsMiracle Mile Pace (2010, 2011)Len Smith Mile (2008, 2010, 2011, 2012)South Australian Cup (2008, 2010, 2012, 2013)New Zealand Free...

 

EP by Alice in Chains For the film, see We Die Young (film). We Die YoungEP by Alice in ChainsReleasedJuly 1990 (1990-07)RecordedDecember 1989 – April 1990StudioLondon Bridge Studio, SeattleCapitol Studios, HollywoodGenre Heavy metal[1][2] grunge[3] alternative rock[2] Length10:08LabelColumbiaProducerDave JerdenAlice in Chains chronology Publisher Demos(1989) We Die Young(1990) Facelift(1990) Alice in Chains singles chronology We Die Young(1...

 

Presiden Republik SingapuraPetahanaTharman Shanmugaratnamsejak 14 September 2023GelarBapak Presiden (informal)Yang mulia (diplomatik)KediamanIstanaDitunjuk olehParlemen (1965–1991)Pemilihan umum (sejak 1991)Masa jabatan6 tahun, dapat dipilih kembali 1 kali lagiDasar hukumKonstitusi Singapura, Pasal 17Pejabat perdanaYusof IshakDibentuk9 Agustus 1955; 68 tahun lalu (1955-08-09)GajiS$1,680,000 per tahunSitus webistana.gov.sg Daftar presiden Singapura Nama Tionghoa Hanzi tradisional: ...

Android-based Smartphone Lenovo Vibe K4 NoteManufacturerLenovo Group LimitedSloganThe killer NoteSeriesK seriesModel A7010a48 A7010 Vibe X3 lite Compatible networks2G (GSM/GPRS/EDGE): 850, 900, 1,800 and 1,900 MHz; 3G (HSDPA HSUPA) 850, 900, 1,900 and 2,100 MHz; 4G (LTE): 800, 850, 900, 1,800, 2,100 and 2,600 First releasedJanuary 2016; 7 years ago (2016-01) (In India)Units sold1.8 Lakhs in the flash saleSuccessorLenovo K5 NoteTypeSmartphoneForm factorTou...

 

Toy gun using percussion caps to simulate gunshots and smoke This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Cap gun – news · newspapers · books · scholar �...

 

Anna Hay, Countess of Winton by Adam de Colone Anna Hay, Countess of Winton (1592-1628) was a Scottish courtier. She was the eldest daughter of Francis Hay, 9th Earl of Erroll and Elizabeth Douglas, Countess of Erroll. At court in England Lady Anna Hay joined the household of Anne of Denmark, the wife of King James VI. She had high status in the household, and after the Union of the Crowns, in England, she and Jean Drummond had footmen.[1] In November 1603 the Spanish ambassador, the ...

1978 post-apocalyptic role-playing game Gamma WorldGamma World 2nd edition Basic Rules Booklet coverDesignersJames M. Ward and Gary JaquetPublishersTSR (1st edition–4th edition)Wizards of the Coast (5th edition, 7th edition)Sword and Sorcery Studios (6th edition)Publication1978 (1st edition)1983 (2nd edition)1986 (3rd edition)1992 (4th edition)2000 (5th edition)2003 (6th edition) 2010 (7th edition)GenresPost-apocalypse, Science fantasySystemsCustom (1st–4th edition)Alternity (5th edition)...

 

Classic rock radio station in East Grand Forks, Minnesota–Grand Forks, North Dakota This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article possibly contains original research. Please improve it by verifying the claims made and adding inline citations. Statements consisting only of original research should be removed. (October 2015) (Learn how and when to remove this template messa...

 
Kembali kehalaman sebelumnya