Son Buzul Çağı
|
Read other articles:
Artikel ini bukan mengenai Jebel Akhdar (Oman). Aljabal Alakhdar (Libya) Jebel Akhdar (Arab: الجبل الأخضر al-Jabal al-Akhḍar, bahasa Indonesia: Gunung Hijau) adalah sebuah wilayah dataran tinggi berhutan di timur laut Libya. Tempat tersebut sekarang terletak di shabiyah atau distrik Derna, Jabal al Akhdar, dan Marj. Referensi Koordinat: 32°35′52″N 21°28′22″E / 32.597734°N 21.472778°E / 32.597734; 21.472778 Pengawasan otoritas Integrated...
Autorità Garante per l'Infanzia e l'AdolescenzaSede dell'AGIA a Roma SiglaAGIA Stato Italia TipoAutorità amministrativa indipendente Istituito12 luglio 2011 GaranteCarla Garlatti Durata mandato4 anni Impiegati20 SedeRoma IndirizzoVia di Villa Ruffo 6, I-00196 Roma Sito webwww.garanteinfanzia.org/ Modifica dati su Wikidata · Manuale L'Autorità Garante per l'Infanzia e l'Adolescenza (AGIA) è un organo monocratico indipendente italiano istituito nel 2011[1] con il compito ...
L'addio a Enrico BerlinguerUn momento dei funeraliPaeseItalia Anno1984 Formatofilm TV Generedocu-drama, drammatico, storico Lingua originaleitaliano CreditiRegiaUgo Adilardi, Silvano Agosti, Gianni Amico, Alfredo Angeli, Giorgio Arlorio, Gioia Benelli, Roberto Benigni, Bernardo Bertolucci, Giuseppe Bertolucci, Paolo Bianchini, Libero Bizzarri, Carlo Di Palma, Luigi Faccini, Giorgio Ferrara, Nicolò Ferrari, Andrea Frezza, Ansano Giannarelli, Franco Giraldi, Francesco Laudadio, Carlo L...
Das Mahnmal für die ermordeten Juden Hannovers auf dem Opernplatz mit der 2013 enthüllten Informationstafel Das Mahnmal für die ermordeten Juden Hannovers wurde 1994 nach einem Entwurf des italienischen Künstlers Michelangelo Pistoletto auf dem Opernplatz aufgestellt, einem der zentralen Plätze Hannovers. Das auf Initiative des Vereins Memoriam aus privaten Spenden errichtete Mahnmal neben dem Opernhaus erinnert an mehr als 6.800 Juden, die Opfer des Nationalsozialismus wurden. Bisher wu...
ПакоPako|coordinates_footnotes= |coor_pinpoint= Пако Основні дані 45°56′22″ пн. ш. 14°22′15″ сх. д. / 45.93972200002777839° пн. ш. 14.37111100002777775° сх. д. / 45.93972200002777839; 14.37111100002777775Координати: 45°56′22″ пн. ш. 14°22′15″ сх. д. / 45.93972200002777839° пн. ш. 14.37111100002777775° сх....
Esta página cita fontes, mas que não cobrem todo o conteúdo. Ajude a inserir referências. Conteúdo não verificável pode ser removido.—Encontre fontes: ABW • CAPES • Google (N • L • A) (Outubro de 2020) Bolívia Alcunhas? La Verde (A Verde)Los Tiahuanacos (Os Tiahuanacos)Los Altiplanicos (Os Altiplânicos) Associação Federação Boliviana de Futebol Confederação CONMEBOL Material desportivo? Marathon Trein...
Indirect conflict between Iran and Saudi Arabia Iran–Saudi Arabia proxy conflictPart of the Arab Winter, the Second Cold WarMap of the current situation in the conflict: Iran Saudi Arabia Proxy conflict locationsDate11 February 1979 – ongoing[74][75](44 years, 9 months, 3 weeks and 2 days)LocationVarious (primarily Middle East)Belligerents Iran Proxies:[1] Hezbollah Al-Hejaz[2] OIRAP[3](1979–19...
Susie Essman Susie Essman (* 31. Mai 1955 in Mount Vernon, New York) ist eine US-amerikanische Komikerin und Schauspielerin. Susie Essman war zunächst als Stand-up-Komikerin aktiv. Seit 1988 wird sie auch als Schauspielerin im komischen Rollenfach besetzt. Bekannt ist sie für ihre Rolle der Susie Greene in der HBO-Sitcom Lass es, Larry!. Filmografie (Auswahl) 1988: Crocodile Dundee II 1988–1989: Baby Boom (Fernsehserie, 13 Folgen) 1991: Turtles II – Das Geheimnis des Ooze (Teenage Mutan...
Hero HindustaniSutradara Aziz Sejawal ProduserDitulis olehKader Khan (Dialog)SkenarioYunus SajawalCeritaYunus SajawalPemeranArshad WarsiNamrata ShirodkarKader KhanPenata musikAnu MalikSinematograferNazeeb KhanPenyuntingWaman BhosleTanggal rilis 23 Oktober 1998 (1998-10-23) NegaraBahasa Hindi Urdu Hero Hindustani adalah sebuah film India 1998 yang disutradarai oleh Aziz Sejawal. Film tersebut dibintangi oleh Arshad Warsi dan Namrata Shirodkar. Pemeran Arshad Warsi sebagai Rommie Nam...
International organization for women Not to be confused with YMCA. For other uses, see YWCA (disambiguation). This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: YWCA – news · newspapers · books · scholar · JSTOR (January 2021) (Learn how and when to remove this template message) YWCAYoung Women's Christian Asso...
Breaded, fried flat piece of meat Snitzel redirects here. For the racehorse, see Snitzel (horse). For other uses, see Schnitzel (disambiguation). SchnitzelTypeCutletPlace of originAustriaRegion or stateCentral EuropeMain ingredientsMeatIngredients generally usedFatVariationsWiener schnitzel Media: Schnitzel A schnitzel (German: [ˈʃnɪt͡sl̩] ⓘ) is a thin slice of meat. The meat is usually thinned by pounding with a meat tenderizer. Most commonly, the meat is breade...
هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أغسطس 2021) دامير هادزيتش معلومات شخصية الميلاد 1 أكتوبر 1984 (العمر 39 سنة)إيزولا الطول 1.89 م (6 قدم 2 1⁄2 بوصة) مركز اللعب مدافع الجنسية سلوفينيا معلومات ا�...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
São Cristóvão e Neves nos Jogos Olímpicos de Verão da Juventude de 2010 Comitê Olímpico Nacional Código do COI SKN Nome Comitê Olímpico de São Cristóvão e Neves «site oficial» (em inglês) Jogos Olímpicos de Verão da Juventude de 2010 Sede Singapura Competidores 2 em 1 esporte Porta-bandeira Lonzo Wilkinson[1] Medalhas Pos.n/d 0 0 0 0 Participações nos Jogos Olímpicos Verão 1996 • 2000 • 2004 • 2008 • 2012 • 2016 • 2020 São Cristóvão e Neves...
US federal government job-creation program (1933–34) Civil Works Administration workers cleaning and painting the gold dome of the Colorado State Capitol (1934) The Civil Works Administration (CWA) was a short-lived job creation program established by the New Deal during the Great Depression in the United States to rapidly create mostly manual-labor jobs for millions of unemployed workers. The jobs were merely temporary, for the duration of the hard winter of 1933–34. President Franklin D...
Трижды наращённый усечённый додекаэдр (3D-модель) Тип многогранник Джонсона Свойства выпуклый Комбинаторика Элементы 62 грани135 рёбер75 вершин Χ = 2 Грани 35 треугольников15 квадратов3 пятиугольника9 десятиугольников Конфигурация вершины 4x3+3x6(3.102) 3+2x6(3.4.5.4) 5x6(3.4.3.1...
Євген ПальченкоЄвген Михайлович Пальченко Старший лейтенант Загальна інформаціяНародження 22 січня 1999(1999-01-22) (24 роки)с. Ометинці, Немирівський район, Вінницька область, УкраїнаНаціональність українецьAlma Mater Національна академія сухопутних військ імені гетьмана Пет�...
Romanian long-distance runner Todoran, preparing for VCM in 2013. Paula Todoran (born 9 June 1985 in Zalău) is a Romanian long-distance runner. Career highlights European Championships 2007 - 4th, 10,000 m (under-23) Personal bests Distance Mark Date Location 5,000 m 15:52.99 10 June 2007 Bucharest 10,000 m 33:12.08 13 July 2007 Debrecen 20,000 m 1:08.32 2 September 2007 Zalău Half marathon 1:12.59 14 October 2007 Udine Marathon 2:47.23 5 October 2014 Bucharest External links Paula Todoran ...
Archaeological museum in Brading, England Brading Roman VillaSite museum housing the mosaics and wallsLocation within Isle of WightGeneral informationLocationBradinggrid reference SZ598862CountryUnited KingdomCoordinates50°40′22″N 1°09′16″W / 50.6728°N 1.1544°W / 50.6728; -1.1544Construction started1st centuryDemolished4th century Brading Roman Villa was a Roman courtyard villa which has been excavated and put on public display in Brading on the Isle of Wig...
This article includes a list of references, related reading, or external links, but its sources remain unclear because it lacks inline citations. Please help to improve this article by introducing more precise citations. (May 2019) (Learn how and when to remove this template message) Andwell PrioryMonastery informationFull namePriory of St. Mary at AndwellOrderBenedictine monksEstablishedearly 12th centuryMother houseTironDedicated toSt. MaryControlled churchesStratton, HintonPeopleFounder(s)...