Share to: share facebook share twitter share wa share telegram print page

PSD (ген)

PSD
Ідентифікатори
Символи PSD, EFA6, EFA6A, PSD1, TYL, pleckstrin and Sec7 domain containing
Зовнішні ІД OMIM: 602327 MGI: 1920978 HomoloGene: 31115 GeneCards: PSD
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001270965
NM_001270966
NM_002779
NM_028627
NM_001347454
RefSeq (білок)
NP_001257894
NP_001257895
NP_002770
NP_001257895.1
NP_001334383
NP_082903
Локус (UCSC) Хр. 10: 102.4 – 102.42 Mb Хр. 19: 46.31 – 46.33 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PSD (англ. Pleckstrin and Sec7 domain containing) – білок, який кодується однойменним геном, розташованим у людей на 10-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 1 024 амінокислот, а молекулярна маса — 109 543[4].

Послідовність амінокислот
1020304050
MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRV
AGPGPRGRELGRVTAPCTPLRGPPSPRVAPSPWAPSSPTGQPPPGAQSSV
VIFRFVEKASVRPLNGLPAPGGLSRSWDLGGVSPPRPTPALGPGSNRKLR
LEASTSDPLPARGGSALPGSRNLVHGPPAPPQVGADGLYSSLPNGLGGPP
ERLATLFGGPADTGFLNQGDTWSSPREVSSHAQRIARAKWEFFYGSLDPP
SSGAKPPEQAPPSPPGVGSRQGSGVAVGRAAKYSETDLDTVPLRCYRETD
IDEVLAEREEADSAIESQPSSEGPPGTAYPPAPRPGPLPGPHPSLGSGNE
DEDDDEAGGEEDVDDEVFEASEGARPGSRMPLKSPVPFLPGTSPSADGPD
SFSCVFEAILESHRAKGTSYTSLASLEALASPGPTQSPFFTFELPPQPPA
PRPDPPAPAPLAPLEPDSGTSSAADGPWTQRGEEEEAEARAKLAPGREPP
SPCHSEDSLGLGAAPLGSEPPLSQLVSDSDSELDSTERLALGSTDTLSNG
QKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVF
TGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGA
HTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALY
SSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRISGGSGSGSSPFLDLT
PEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWKSFHGILKGMILYLQKE
EYKPGKALSETELKNAISIHHALATRASDYSKRPHVFYLRTADWRVFLFQ
APSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQ
EEQVRTHEAKLKAMASELREHRAAQLGKKGRGKEAEEQRQKEAYLEFEKS
RYSTYAALLRVKLKAGSEELDAVEAALAQAGSTEDGLPPSHSSPSLQPKP
SSQPRAQRHSSEPRPGAGSGRRKP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, клітинних відростках.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:9507 (англ.) . Архів оригіналу за 10 вересня 2015. Процитовано 19 вересня 2017. [Архівовано 2015-09-10 у Wayback Machine.]
  4. UniProt, A5PKW4 (англ.) . Архів оригіналу за 25 вересня 2017. Процитовано 19 вересня 2017.

Див. також

Read other articles:

Vườn quốc định Akiyoshidai秋吉台国定公園IUCN loại V (Khu bảo tồn cảnh quan đất liền/biển)Akiyoshidai với các khối đá vôiQuốc định Vườn quốc gia AkiyoshidaiVị tríYamaguchi, Nhật BảnThành phố gần nhấtMineTọa độ34°13′55″B 131°18′10″Đ / 34,232°B 131,3027°Đ / 34.2320; 131.3027[1]Diện tích45,02 kilômét vuông (17 dặm vuông Anh)Thành lập1 tháng 11 n

 

Baltimore Pike Estación del Metro de FiladelfiaUbicaciónCoordenadas 39°55′52″N 75°17′34″O / 39.9312, -75.2928Dirección Baltimore Pike & Calle OdgenClifton Heights, PensilvaniaDatos de la estaciónServicios N.º de andenes 2 plataformas lateralesN.º de vías 2 víasAdministración Autoridad de Transporte del Sureste de PensilvaniaLíneasLínea(s) █102 « Calle Penn ←      → Creek Road » Mapa Baltimore Pike Ubicación de la estación ...

 

De UEFA Super Cup 1994 bestond uit twee voetbalwedstrijden die gespeeld werden in het kader van de UEFA Super Cup. De wedstrijden vonden plaats tussen de winnaar van de UEFA Champions League 1993/94, AC Milan, en de winnaar van de Europacup II 1993/94, Arsenal FC, op 1 februari en 8 februari 1995. De eerste wedstrijd werd in het Arsenal Stadium gespeeld en eindigde in een gelijkspel. Later eindigde de tweede wedstrijd, in het Stadio Giuseppe Meazza, in een 2-0-overwinning voor AC Milan. Zo sl...

Historic house in Pennsylvania, United States United States historic placeSehner-Ellicott-Von Hess HouseU.S. National Register of Historic Places Ellicott House, April 2010Show map of PennsylvaniaShow map of the United StatesLocation123 N. Prince St., Lancaster, PennsylvaniaCoordinates40°2′22″N 76°18′28″W / 40.03944°N 76.30778°W / 40.03944; -76.30778Area0.2 acres (0.081 ha)Builtc. 1780Built bySehner, GeorgeArchitectural styleGeorgianNRHP refe...

 

Something New EP de TaeyeonPublicación 18 de junio de 2018Género(s) K-popFormato CD descarga digitalDiscográfica SM Entertainment Iriver IncProductor ejecutivo Lee Soo-man Cronología de Taeyeon This Christmas: Winter is Coming (2018) Something New (2018) Voice (2019) Sencillos de Something New «Something New»Publicado: 18 de junio de 2018 [editar datos en Wikidata] Something New es el cuarto EP de la cantante surcoreana Taeyeon. El álbum fue lanzado el 18 de junio de 2018 por...

 

Sampul novel Dracula pertama kali oleh Archibald Constable dan Company of Westminster Dracula adalah novel tentang seorang bangsawan vampir bernama Count Dracula, karya penulis Irlandia, Bram Stoker. Novel ini merupakan novel kelima dari sang penulis dan dipublikasikan pertama kali oleh Archibald Constable dan Company of Westminster.[1] Dalam bahasa Indonesia sering kali dilafalkan Drakula merujuk kepada Count Dracula sebagai vampir penghisap darah.[butuh rujukan] Novel ini be...

Oost Gelre Gemeente in Nederland (Details) (Details) Situering Provincie Gelderland Gelderland COROP-gebied Achterhoek Coördinaten 51° 59′ NB, 6° 35′ OL Algemeen Oppervlakte 110,44 km² - land 109,93 km² - water 0,51 km² Inwoners (31 januari 2023) 29.863? (272 inw./km²) Bestuurscentrum Lichtenvoorde (gemeentehuis); Groenlo (stadhuis/gemeenteraadslocatie) Belangrijke verkeersaders N18 N312 N313 N319 treinverbinding Zutphen - Winterswijk Politiek Burgemeester (lijst) Annette B...

 

BuzzFeed, Inc.Jenis usahaSwastaJenis situsHiburanBeritaBahasaInggrisPrancisSpanyolHindiArabJermanPortugisJepangDidirikan1 November 2006; 17 tahun lalu (2006-11-01)MarkasNew York City, U.S.PendiriJonah PerettiJohn S. Johnson IIITokoh pentingJonah Peretti (CEO)Dao Nguyen (Penerbit)Ben Smith (Kepala penyunting)Lee Brown (CRO)Carole Robinson (CCO)Rhonda Powell (Kounsel umum)Eric W. Muhlheim (CFO)Pendapatan US$167 juta (2015)[1][2]Karyawan1.700 (Desember 2017)[3]S...

 

Township in Burlington County, New Jersey, United States Township in New Jersey, United StatesMount Holly, New JerseyTownshipView southward along County Route 541 in Mount Holly SealLocation of Mount Holly in Burlington County highlighted in red (right). Inset map: Location of Burlington County in New Jersey highlighted in red (left).Census Bureau map of Mount Holly Township, New Jersey Interactive map of Mount Holly, New JerseyMount HollyLocation in Burlington CountyShow map of Burlington Co...

Bagian dari seriIslam Rukun Iman Keesaan Allah Nabi dan Rasul Allah Kitab-kitab Allah Malaikat Hari Kiamat Qada dan Qadar Rukun Islam Syahadat Salat Zakat Puasa Haji Sumber hukum Islam al-Qur'an Sunnah (Hadis, Sirah) Tafsir Akidah Fikih Syariat Sejarah Garis waktu Muhammad Ahlulbait Sahabat Nabi Khulafaur Rasyidin Khalifah Imamah Ilmu pengetahuan Islam abad pertengahan Penyebaran Islam Penerus Muhammad Budaya dan masyarakat Akademik Akhlak Anak-anak Dakwah Demografi Ekonomi Feminisme Filsafat...

 

Sastra Sastra lisan Folklor Dongeng Lagu Legenda Mitos Peribahasa Wiracarita Penampilan Buku audio Permainan panggung Pidato Genre tertulis utama Drama Pementasan Komedi Tragedi Tragikomedi Puisi Epik Lirik Prosa Cerita pendek Novel/Roman Novela Fiksi Bacaan anak Cinta Kejahatan Sejarah Spekulatif Fantasi Ilmiah Satir Nonfiksi Akademik Filsafat Sejarah Epistola Kehidupan Autobiografi Biografi Buku harian Memoar Kewartawanan Perjalanan Surat Sejarah dan daftar Sejarah Kontemporer Garis besar G...

 

This article is about the 1960s homophile magazine. For the leather subculture magazine, see Drummer (magazine). For the percussion magazine, see DRUM! DrumDrum issue number 27, October 1967EditorClark PolakCategoriesNews, Literature, EroticaFrequencyMonthlyCirculation10,000PublisherJanus Society / Drum Publishing Co.First issue1964Final issue1969CountryUSABased inPhiladelphia, PennsylvaniaLanguageEnglishISSN0418-0933 Drum (sometimes subtitled Drum: Sex in Perspective) was an American gay men...

Not to be confused with Yusuf Najmuddin II. This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (September 2010) (Learn how and when to remove this template message) Tomb of Yusuf Najmuddin ibn Sulaiman, Tayba, Yemen Part of a series on IslamIsma'ilism Concepts Quran Taʾwīl Imamate Ẓāhir Bātin Nūr 'Aql ʿIlm Daʿwa Dāʿī Bāb Hujja Satr Taqiya Pīr Numero...

 

Russian zoologist Grigory Grum-Grshimailo Grigory Yefimovich Grum-Grshimailo (Russian: Григо́рий Ефи́мович Грумм-Гржима́йло, 1860–1936) was a Russian zoologist best known for his expeditions to Central Asia (Pamir, Bukhara, Tianshan, Gansu, and Kukunor), western Mongolia and Tuva, and the Russian Far East. In literature his name is sometimes spelled as Grigor Efimowitsch Grumm-Grzhimailo or Grigory Yefimovich Grumm-Grzhimaylo. Life and work Born in St. ...

 

2003 American sci-fi action film The Matrix RevolutionsTheatrical release posterDirected byThe Wachowskis[a]Written byThe WachowskisBased onCharactersby The WachowskisProduced byJoel SilverStarring Keanu Reeves Laurence Fishburne Carrie-Anne Moss Hugo Weaving Jada Pinkett Smith CinematographyBill PopeEdited byZach StaenbergMusic byDon DavisProductioncompanies Warner Bros. Pictures Village Roadshow Pictures NPV Entertainment Silver Pictures Distributed byWarner Bros. PicturesRelease da...

Zoo in the Ashanti Region of Ghana Kumasi ZooA Chimpanzee in an enclosure at the Kumasi Zoo.Date opened1957 (1957)LocationKumasi, Ashanti Region, GhanaLand area370 acres (150 ha)No. of animals135No. of species40 The Kumasi Zoo (Kumasi Zoological Garden) is a zoo located in the heart of Kumasi in the Ashanti Region of Ghana. The zoo occupies a 1.5-square-kilometre (370-acre) area between the Kejetia Bus Terminal, the old race course and the Kumasi Centre for National Culture.[1&#...

 

Right to collective action Part of a series onLibertarianism Concepts Abstention Age of consent reform Anti-authoritarianism Anti-capitalism Antimilitarism Anti-statism Class struggle Counter-economics Crypto-anarchism Decentralization Departurism Direct action Economic freedom Egalitarianism Evictionism Expropriative anarchism Federalism (anarchist) Free association (Marxism and anarchism) Free love Free market Free-market environmentalism Free migration Free trade Freedom of association Fre...

 

The Right ReverendJohn MackarnessBishop of OxfordDioceseDiocese of OxfordPredecessorSamuel WilberforceSuccessorWilliam StubbsOrdersOrdination18 May 1845Consecration25 January 1870Personal detailsBorn(1820-12-03)3 December 1820Islington, Middlesex, United KingdomDied16 September 1889(1889-09-16) (aged 68)Eastbourne, Sussex, UKNationalityBritishDenominationAnglicanSpouseAlethea Buchanan ColeridgeAlma materEton College;Merton College, Oxford John Fielder Mackarness[1] (3 December 18...

  ميّز عن برج العرب الجديدة.   لمعانٍ أخرى، طالع برج العرب (توضيح). برج العرب الميدان الرئيسي بالمدينة تقسيم إداري البلد  مصر عاصمة لـ مركز برج العرب المحافظة محافظة الإسكندرية المركز مركز برج العرب المسؤولون المحافظ محمد الشريف رئيس المركز طه زهير[1] خصائص �...

 

A major contributor to this article appears to have a close connection with its subject. It may require cleanup to comply with Wikipedia's content policies, particularly neutral point of view. Please discuss further on the talk page. (July 2021) (Learn how and when to remove this template message) American TV series or program The 90'sGenreDocumentaryDirected byMiscellaneousCountry of originUnited StatesOriginal languageEnglishNo. of series4No. of episodes52ProductionExecutive producerTo...

 
Kembali kehalaman sebelumnya