INFOSEKOLAH.NET

Der englische Ausdruck case sensitivity bezeichnet in der elektronischen Datenverarbeitung allgemein die Art und Weise, in der eine Benutzerschnittstelle...

sensorischer Verarbeitungssensitivität (englisch: Sensory Processing Sensitivity SPS). Die basale Forschungstätigkeit zu dem als Persönlichkeitsdisposition...

werden von den Radargeräteherstellern in ihren Gerätedokumentationen Sensitivity Time Control (STC) oder Gain Time Control (GTC) genannt. Solche Schaltungen...

non-celiac wheat sensitivity (NCWS), synonym: Weizensensitivität, früher Nicht-Zöliakie-Glutensensitivität, englisch non-celiac gluten sensitivity (NCGS) oder...

Der Moisture Sensitivity Level (MSL; deutsch „Feuchtigkeitsempfindlichkeitsschwellwert“) bezieht sich auf die Feuchteempfindlichkeit von Halbleiterbauelementen...

Developments in Composition C-4: Towards an Alternate Binder and Reduced Sensitivity. BAE Systems OSI, abgerufen am 3. Mai 2019 (englisch).  Whitesides JD...

Chemikalienunverträglichkeit (abgekürzt MCS von englisch Multiple Chemical Sensitivity), auch idiopathische Umweltintoleranz oder idiopathische Umwelt-Unverträglichkeit...

Die Reinforcement Sensitivity Theorie (RST) von Jeffrey Alan Gray ist eine Modifikation des Temperamentsmodells von Hans Jürgen Eysenck. Die Theorie unterteilt...

PMC 28302 (freier Volltext). H. Alzate, M. L. Londono: Vaginal erotic sensitivity. In: J Sex Marital Ther. 10, 1984, S. 49–56. Karl Knörr, Henriette Knörr-Gärtner...

Kleinschreibung bei Pfad- und Dateinamen, was auch als englisch Case sensitivity bezeichnet wird. Für diese auch als HFSX bezeichnete Variante wird eine...

Dateisysteme, zwischen Groß- und Kleinschreibung unterscheidet (Case sensitivity), kann es bei der Nutzung unter Betriebssystemen welche Groß- und Kleinschreibung...

Anzahl von Dateien per Verzeichnis erhöht (large_dir) ab Kernel 5.2: Case sensitivity kann nun optional ausgeschaltet werden (casefold) ab Kernel 5.4: Unterstützung...

lamarckii. Blue jellyfish. In: Marine Life Information Network: Biology and Sensitivity Key Information Subprogramme, Plymouth: Marine Biological Association...

Theory. 2. Auflage. Sage, London 2014. Barney G. Glaser: Theoretical Sensitivity. Advances in the Methodology of Grounded Theory. Sociology Press, Mill...

Epid. Bull. Nr. 9, März 2006 (rki.de [PDF]).  Alice Reyn: Antibiotic sensitivity of gonococcal strains isolated in the South-East Asia and Western Pacific...

unterschieden zwischen Gleichgewichtsklimasensitivität (Equilibrium climate sensitivity – ECS) und transienter Klimaantwort (Transient climate response – TCR)...

reduces pressure pain sensitivity in humans without involvement of beta-endorphin(1-31), but does not reduce heat pain sensitivity. In: Neuroendocrinology...

Weiter­verarbeitung einer Trocknung (baking) unterzogen werden müssen, um Schäden beim Lötprozess zu vermeiden; Details unter Moisture Sensitivity Level...

No Effects of Gluten in Patients With Self-Reported Non-Celiac Gluten Sensitivity After Dietary Reduction of Fermentable, Poorly Absorbed, Short-Chain...

Jastreboff geprägt. Ein häufig verwendetes Synonym ist selective sound sensitivity syndrome, auf Deutsch etwa „Selektives Geräuschempfindlichkeits-Syndrom“...

Der Process Sensitivity Level (PSL, englisch, dt. in etwa Prozessempfindlichkeitsklasse) beschreibt die Empfindlichkeit eines elektronischen Bauelements...

PMC 28302 (freier Volltext). H. Alzate, M. L. Londono: Vaginal erotic sensitivity. In: Journal of Sex & Marital Therapy. Band 10, 1984, S. 49–56. Jian...

 Oktober 2025 (englisch).  Bella Hadid shocked and upset over 'lack of sensitivity' in Adidas campaign. 30. Juli 2024, abgerufen am 25. Oktober 2025 (britisches...

Darstellung. Oldenbourg, München 1976, ISBN 3-486-34811-6 Assem Deif: Sensitivity Analysis in Linear Systems. Springer, Berlin 1986, ISBN 3-540-16312-3...

M. J. Quon: Quantitative insulin sensitivity check index: a simple, accurate method for assessing insulin sensitivity in humans. In: J Clin Endocrinol...

Allgeier, Carsten A. Brühl: Decreasing Bacillus thuringiensis israelensis sensitivity of Chironomus riparius larvae with age indicates potential environmental...

Scholz, Ralf Reski: Gelrite and agar differently influence cytokinin-sensitivity of a moss. In: Journal of Plant Physiology Bd. 146, 1995, S. 369–371...

bei 67,42 %. Kaynoosh Homayouni, Seyedeh Halimeh Jafari, Hossein Yari: Sensitivity and Specificity of Modified Bragard Test in Patients With Lumbosacral...

Collaboration: Direct neutrino-mass measurement with sub-electronvolt sensitivity. In: Nature Physics. Band 18, Nr. 2, Februar 2022, ISSN 1745-2481, S...

Determined by Liquid Chromatography Combined With Tandem Mass Spectrometry: Sensitivity of the DRI Assay at 100 ng/ml Cut-Off and Validity of Semiquantitative...

 587–593 (upenn.edu [PDF]).  Canon succeeds in developing world’s largest CMOS image sensor, with ultra-high sensitivity. Abgerufen am 25. Juni 2018...

Lifeguard 2014: Shirin in Love 2014: Frontera 2016: Buried Child 2016: Sensitivity Training 2016: How to Get Away with Murder (Fernsehserie, Folge 3x02)...

C, Barrós A, Ortet G, Antònia Parcet M, Ibañez MI: Set-shifting and sensitivity to reward: A possible dopamine mechanism for explaining disinhibitory...

Watanabe (Japan): The Earth’s Energy Budget, Climate Feedbacks and Climate Sensitivity Supplementary Material. (PDF) In: IPCC. Abgerufen am 14. August 2024...

Rasseverteilung des MDR1-Defekts K. L. Mealey, S. A. Bentjen et al.: Ivermectin sensitivity in collies is associated with a deletion mutation of the mdr1 gene. In:...

Paraplegiker-Stiftung Segmental progeroide Syndrome, siehe Progerie Sensory Processing Sensitivity, siehe Hochsensibilität Service de Presse Suisse, Kulturverein Sheppard...

gehören Anxiety Sensitivity Index (ASI), Anxiety Sensitivity Profile (ASP), Anxiety Sensitivity Index-Revised (ASI-R), Anxiety Sensitivity Index-3 (ASI-3)...

(englisch, Online [PDF]).  Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: PNAS. Band 110...

Der BSE Sensex (Bombay Stock Exchange Sensitivity Index) ist der bekannteste und wichtigste Aktienindex an der Bombay Stock Exchange (BSE) in Indien....

doi:10.1073/pnas.0805312105. A natural polymorphism alters odour and DEET sensitivity in an insect odorant receptor. Nature 478, 511–514 (27. Oktober 2011);...

Messbedingungen und Messverfahren für Typprüfungen" Umrechnung von Kennschalldruckpegel und Wirkungsgrad bei passiven Lautsprechern (sensitivity)...

Acquisition Spin Echo Enhanced SE: Spin-Echo 90°–180°-Pulsfolge SENSE: Sensitivity-Encoded SMASH: Simultaneous Acquisition of Spatial Harmonics SPGR: Spoiled...

Walter B. Shelley, Howard M. Rawnsley: Aquagenic urticaria: Contact sensitivity to water. In: The Journal of the American Medical Association (JAMA)...

22672847. F. Vaiano, F. Mari, F. P. Busardò, E. Bertol: Enhancing the sensitivity of the LC-MS/MS detection of propofol in urine and blood by azo-coupling...

(Review). K. Staebler, E. Helbing, C. Rosenbach, B. Renneberg: Rejection sensitivity and borderline personality disorder. In: Clinical psychology & psychotherapy...

Whiting (2003): The problem with ‘‘the Paleoptera Problem:’’ sense and sensitivity. Cladistics 19: S. 432–442. K. M. Kjer, F. L. Carle, J.Litman, J. Ware...

Gräfe: Measuring depression outcome with a brief self-report instrument: Sensitivity to change of the Patient Health Questionnaire (PHQ-9). In: J Affect Disord...

orientation and navigation of juvenile alligators: evidence of magnetic sensitivity. In: Journal of Comparative Physiology A. Band 154, Nr. 5, 1984, S. 649–658...

Glenn: Extreme physiological adaptations as predictors of climate‐change sensitivity in the narwhal, Monodon monoceros. In: Marine Mammal Science, Band 27...

PMID 10600954, PMC 28302 (freier Volltext). Z. Hoch: Vaginal erotic sensitivity by sexological examination. In: Acta Obstetricia et Gynecologica Scandinavica...

Grunewald, Marios Hadjivassiliou: Movement Disorders Related to Gluten Sensitivity: A Systematic Review. In: Nutrients. Band 10, Nr. 8, 8. August 2018,...

Scripting Language, Scriptsprache des IRC-Clients, siehe mIRC Moisture Sensitivity Level („Feuchtigkeitsempfindlichkeitsschwellwert“) in der Halbleitertechnik...

S. 60 (englisch).  Mary Pols: Where the Wild Things Are: Sendak with Sensitivity. In: Time. Time Inc., 14. Oktober 2009, abgerufen am 14. März 2017 (englisch...

Die Empfindlichkeit (engl. sensitivity) ist in der Messtechnik definiert als die „Änderung des Wertes der Ausgangsgröße eines Messgerätes bezogen auf...

niederländische Getränkemarke SISI steht als Abkürzung für: Short Increment Sensitivity Index, Verfahren der subjektiven Audiometrie, siehe SISI-Test Siehe auch:...

Ökonom Peter van Westendorp entwickelte 1976 ein Modell (englisch Price-Sensitivity-Meter) zur Feststellung der Zahlungsbereitschaft und Preissensitivität...

und K.M. Meurs (2008): Breed distribution of the ABCB1-1Δ (multidrug sensitivity) polymorphism among dogs undergoing ABCB1 genotyping. JAVMA 233(6):921-4...

978-3-621-27614-6, S. 505–508. Kurt Freund, Robin J. Watson: Assessment of the sensitivity and specificity of a phallometric test: An update of phallometric diagnosis...

2018 im Internet Archive)). J. A. Hall, F. J. Bernieri: Interpersonal Sensitivity, Theory and Measurement. London 2001, S. 21 f. und Paul Ekman: Gefühle...

Feinfühligkeit ist ein durch Mary Ainsworth geprägter Begriff (engl. maternal sensitivity) aus der Psychologie frühkindlicher Bindungen und bezeichnet die Qualität...

Héchard, Philippe Hartemann, Philippe Humeau, Marie-Cécile Trouilhé: Sensitivity of Vermamoeba (Hartmannella) vermiformis cysts to conventional disinfectants...

Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. 584. Jahrgang, Nr. 7822, August 2020, ISSN 1476-4687...

nature.com pik-potsdam.de (PDF; 515 kB) James Hansen u. a.: Climate sensitivity, sea level and atmospheric carbon dioxide. In: Royal Society Publishing...

Kingsley Publishers, London 2007, ISBN 978-1-84642-559-2, 11. Sensory Sensitivity, S. 271 ff.  Mandy Roy et al.: Das Asperger-Syndrom im Erwachsenenalter...

John Ellis, N. E. Mavromatos, D. V. Nanopoulos, Subir Sarkar: Potential Sensitivity of Gamma-Ray Burster Observations to Wave Dispersion in Vacuo. In: Nature...

Grounded-Theory-Methodologien. Darüber veröffentlichte er Theoretical Sensitivity (1978) und mehrere weitere Methodologien und Sammelbände zur Grounded...

Stability of SARS coronavirus in human specimens and environment and its sensitivity to heating and UV irradiation. Biomed Environ Sci. September 2003;16(3):...

Hutchinson, Richard D. Pancost: Global mean surface temperature and climate sensitivity of the early Eocene Climatic Optimum (EECO), Paleocene–Eocene Thermal...

erzeugen, wird Standard-Ausgangsempfindlichkeit (englisch: standard output sensitivity (SOS)) genannt. In den Rohdaten einer fotografierten Rastergrafik werden...

Camerimage 1996: Special Award Film Direction with a Special Visual Sensitivity Cinequest San Jose Film Festival 1998: Maverick Tribute Award David di...

Gropp: Spillover Effects among Financial Institutions: A State-Dependent Sensitivity Value-at-Risk Approach. In: Journal of Financial and Quantitative Analysis...

Hereditäre Autosomal-rezessive primäre Mikrozephalie MCS Multiple Chemical Sensitivity Vielfache Chemikalienunverträglichkeit MCS Minimally conscious state...

MAGIC Telescopes La Palma, Gamma-ray astronomy at low energies with high sensitivity Informationsschreiben der BG RCI (Memento vom 2. April 2015 im Internet...

S. 222–260, hier S. 240–241. Mark E. Daly: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...

changes in the target P450 CYP51 enzyme associated with altered triazole-sensitivity in fungal pathogens of cereal crops. International Symposium on Cytochrome...

between Wheat and Spelt Bread in Patients with Suspected Non-Celiac Wheat Sensitivity. In: Nutrients. Band 14, Nr. 14, 7. Juli 2022, S. 2800, doi:10.3390/nu14142800...

Accelerating changes in ice mass within Greenland, and the ice sheet’s sensitivity to atmospheric forcing. In: Proceedings of the National Academy of Sciences...

klein. Die Bezeichnung S bezieht sich auf die höhere Empfindlichkeit (=sensitivity) der Kamerasensoren unter Verzicht auf höhere Auflösung. Diese Kamera...

April 2014 im Handel erhältlich ist. Die Bezeichnung S steht dabei für sensitivity, also die höhere Lichtempfindlichkeit des Sensors unter Verzicht auf...

verschiedenen medialen Kontexten tätig und begleitet regelmäßig Produktionen mit Sensitivity Reading. Sie war maßgeblich an der inhaltlichen Beratung für den Film...

Li, Y. (2014). Effect of oat intake on glycaemic control and insulin sensitivity: A meta-analysis of randomised controlled trials. British Journal of...

SM, Erreger K, Yuan H et al.: Subunit-specific mechanisms and proton sensitivity of NMDA receptor channel block. In: J Physiol. 581. Jahrgang, Pt 1, 2007...

(Multidrug Sensitivity) und somit des MDR1-Defekts. K.L. Mealey und K.M. Meurs (2008): Breed distribution of the ABCB1-1Δ (multidrug sensitivity) polymorphism...

doi:10.1002/ejoc.200300570. Alexander B. Fialkov, Urs Steiner u. a.: Sensitivity and noise in GC–MS: Achieving low limits of detection for difficult analytes...

Hutchinson, Richard D. Pancost: Global mean surface temperature and climate sensitivity of the early Eocene Climatic Optimum (EECO), Paleocene–Eocene Thermal...

Cosmological Constant in LQG Vertex Amplitude G. Amelino-Camelia, Potential Sensitivity of Gamma-Ray Burster Observations to Wave Dispersion in Vacuo G. Amelino-Camelia...

administration of dark chocolate is followed by a significant increase in insulin sensitivity and a decrease in blood pressure in healthy persons. In: American Journal...

Mucinous advanced epithelial ovarian carcinoma: clinical presentation and sensitivity to platinum-paclitaxel-based chemotherapy, the GINECO experience. In:...

Verwundbarkeit als eine Funktion von Exposition (exposure), Sensitivität (sensitivity) und Anpassungsfähigkeit (adaptive capacity) verstanden: Exposition umfasst...

Synonyme, Übersetzungen Mark E. Daly u. a.: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...

Schofield, Ian S. Baker: Dissociative tendencies, sensory processing sensitivity and aberrant salience as predictors of anomalous experiences and paranormal...

heart rate variability, blood pressure variability and baroreceptor sensitivity during rest and head-up tilt. In: Blood Pressure Monitoring. Band 10...

Phosphocreatine Circuit: Molecular and Cellular Physiology of Creatine Kinases, Sensitivity to Free Radicals, and Enhancement by Creatine Supplementation. In: Molecular...

Strassberg: Validation of the Behavioral Dyscontrol Scale-Electronic Version: Sensitivity to subtle sequelae of mild traumatic brain injury. In: Brain Injury....

Schmerzschwelle erfassen. Martin S. Angst, Nicholas G. Phillips u. a.: Pain sensitivity and opioid analgesia. A pharmacogenomic twin study. In: Pain, Band 153...

Abgerufen am 8. April 2025 (deutsch).  Matthew Gibbs u. a.: Bitter taste sensitivity in domestic dogs (Canis familiaris) and its relevance to bitter deterrents...

(digitale-sammlungen.de).  T. Aran Mooney et al.: Potential for Sound Sensitivity in Cephalopods. In: Arthur Popper, Anthony Hawkins (Hrsg.): The Effects...

0812721106 (englisch, pnas.org).  Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: pnas. 110...

Jonathan J. Wisco: The components of the adolescent brain and its unique sensitivity to sexually explicit material. In: Journal of Adolescence. Band 72, April...

general circulation model and application to Atlantic heat transport sensitivity. In: Journal of Geophysical Research 104 (1999), S. 29529-29547. DOI:...

D. J. Luecken, S. L. Napelenok, M. Strum, R. Scheffe, S. Phillips: Sensitivity of Ambient Atmospheric Formaldehyde and Ozone to Precursor Species and...

Schoelkopf, Nikoleta Tushteva: Long-Term Volatility Shapes the Stock Market's Sensitivity to News. In: Journal of Econometrics. 2023, ISSN 1556-5068, doi:10.1016/j...

Greenberg, J. P. Vonsattel: Diagnosis of cerebral amyloid angiopathy. Sensitivity and specificity of cortical biopsy. In: Stroke. 1997 Jul;28(7), S. 1418–1422...

veränderte Groß- und Kleinschreibung keinen Unterschied macht (keine case sensitivity). Die optionale Dateinamenserweiterung ist Teil des Dateinamens. Ein...

Yun: Structural and mechanistic underpinnings of the differential drug sensitivity of EGFR mutations in non-small cell lung cancer. In: Biochimica et Biophysica...

Riebold et al.: A C-terminal HSP90 inhibitor restores glucocorticoid sensitivity and relieves a mouse allograft model of Cushing disease. In: Nature Medicine...

Oktanzahl. Die Differenz zwischen ROZ und MOZ wird als „Empfindlichkeit“ (sensitivity) bezeichnet und bringt die Temperaturabhängigkeit der Oktanzahl zum Ausdruck...

von Dirk Kummer nach einem Drehbuch von Uli Brée vor der Kamera. Als Sensitivity-Beraterin fungierte Julia Monro. Premiere war am 5. Juli 2024 am Filmfest...

Hall (1979): A cross-national study of gender differences in nonverbal sensitivity. Unveröffentlichtes Manuskript, Northeastern University, Boston (Massachusetts)...

Nature Schmittner u. a. 2011, J. Climate Schmittner u. a.: Climate Sensitivity Estimated from Temperature Reconstructions of the Last Glacial Maximum...

studies examining the effects of cannabis use on motivation and reward sensitivity have yielded mixed findings. We conclude that cross-sectional evidence...

S. 4–10, hier: S. 4 und 7–8. Mark E Daly: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...

16. Oktober 2015.  N. Grizenko, R. M. Rodrigues Pereira, R. Joober: Sensitivity of scales to evaluate change in symptomatology with psychostimulants...

Urinary House Soiling (Periuria) in Cats and Its Differentiation: The Sensitivity and Specificity of Common Diagnostic Signs. In: Front Vet Sci 5, 2018...

leicht veränderten Formulierungen kann die Prompt-Sensitivity getestet werden. Bei hoher Prompt-Sensitivity sind die Resultate fraglich. Als Reflexion-Prompting...

Michael J. Friedlander: Postnatal development of the spatial contrast sensitivity of X- and Y-cells in the kitten retinogeniculate pathway. In: Journal...

gruppendynamisches Laboratorium, Encounter-Gruppe, Gruppenpsychotherapie, Sensitivity Training); siehe auch National Training Laboratory (NTL). Das Jugendgerichtsgesetz...

Against, S 79. “[…] a disgraceful and distasteful assault on religious sensitivity.” Robert E. A. Lee, zitiert in Hewison, Monty Python: The Case Against...

jeweils mit einem Empfindlichkeitsleitwert Sv (englisch speed value / sensitivity) in Belichtungsstufen gemäß dem APEX-System. Der Standard der Internationalen...

Nisbett: Attending holistically versus analytically: comparing the context sensitivity of Japanese and Americans. In: Journal of Personality and Social Psychology...

zwischen Groß- und Kleinschreibung unterschieden wird (englisch Case sensitivity), ist abhängig von der Interpretation durch die Domain des Empfängers...

autofahrenohneangst.com N. B. Schmidt, M. J. Zvolensky, Maner JK: Anxiety sensitivity: Prospective prediction of panic attacks and Axis I pathology. In: Journal...

Übertragungsfaktor z. T. nicht in der SI-Einheit mV/Pa angegeben, sondern als sensitivity in dB bzw. in V o l t d y n / c m 2 , {\displaystyle \mathrm {\frac {Volt}{dyn/cm^{2}}}...

Die Deutsche Bühne, Heft Nr. 7/2000 (PDF; 589 kB) David Briggs: Out of sensitivity to Jews, changes made in Passion play, but 'blood curse' remains Tampa...

The eyes of oilbirds (Steatornis caripensis): pushing at the limits of sensitivity. In: Naturwissenschaften. Band 91, Nr. 1, 2004, S. 26–29, doi:10.1007/s00114-003-0495-3...

Cushing-Syndrom, eine Pferdekrankheit Klimasensitivität (Equilibrium Climate Sensitivity, Gleichgewichts-Klimasensitivität) Erlangen Classification System, System...

2006, ISBN 3-89602-697-6. Maren Volkmann: ‚Heulsusen-pop‘. New Male sensitivity in German independent music. In: Michael Ahlers, Christoph Jacke (Hrsg...

KM. Meurs (2008): Breed distribution of the ABCB1-1Delta (multidrug sensitivity) polymorphism among dogs undergoing ABCB1 genotyping. In: JAVMA 233(6):921-4...

Taylor: Facial Complexity in Sun Bears: Exact Facial Mimicry and Social Sensitivity. In: Scientific Reports. Band 9, Nr. 1, 21. März 2019, ISSN 2045-2322...

 785–786 (google.com [abgerufen am 28. März 2023]).  S. Yolsal, T. Taymaz: Sensitivity Analysis on Relations Between Earthquake Source Rupture Parameters and...

Redefining the intraepithelial lymphocytes threshold to diagnose gluten sensitivity in patients with architecturally normal duodenal histology: Mild enteropathy...

H. Goldie, A. J. Coldman: A mathematic model for relating the drug sensitivity of tumors to their spontaneous mutation rate. In: Cancer Treat Rep. 63...

Topal, G. Gergely, A. Erdohegyi, G. Csibra, A. Miklosi: Differential Sensitivity to Human Communication in Dogs, Wolves, and Human Infants. In: Science...

Lars Moller: mprisonment and women’s health: concerns about gender sensitivity, human rights and public health. In: Bulletin of the World Health Organization...

2020]).  Prof. Dr. med. Ugur Sahin. In: SFB 1399: Mechanisms of Drug Sensitivity and Resistance in Small Cell Lung Cancer. Department of Translational...

5194/acp-13-11221-2013. Tilmes, S., Müller, R., & Salawitch, R. (2008). The sensitivity of polar ozone depletion to proposed geoengineering schemes. Science...

u. a.: A double-blind study of symptom provocation to determine food sensitivity. In: NEJM 323, 1990, S. 429–433. PMID 2374564. G. Liccardi u. a.: Evaluation...

Biagtan, R. Viswanathan, R. K. Bush: Immunotherapy for house dust mite sensitivity: where are the knowledge gaps? In: Current allergy and asthma reports...

76, Heft 4, 2008, S. 753–774; G. D. Atlas, M. A. Them: Narcissism and sensitivity to criticism: A preliminary investigation. In: Current Psychology. Band...

das Sensitivitätstraining oder die T(rainings)-Gruppe (engl. auch als sensitivity training group bezeichnet), die ein Grundmodell jeder Selbsthilfegruppe...

Phantastik-Literaturpreis Seraph ausgezeichnet. Katharina Seck ist außerdem als Sensitivity Readerin tätig und setzt sich aktiv für Gleichberechtigung, Inklusion...

3-910098-19-3 Systeme der Audiosignalverarbeitung (PDF; 4,48 MB) Mikrofonpegel und ihre Bezugswerte (PDF; 200 kB) Mikrofon-Empfindlichkeit (sensitivity)...

nach England, wo FGM zwar seit 1985 verboten ist, die Toleranz („ethnic sensitivity“) gegenüber dieser archaischen Tradition jedoch als größer eingeschätzt...

saudi-arabisches Telekommunikationsunternehmen Schenefelder TC, einen Tennisclub Sensitivity Time Control, eine Radarbaugruppe Short Time Constant, eine weitere Radarbaugruppe...

31, 2007, S. 1476–1489. PMID 17895748 R. L. Jones u. a.: Differential sensitivity of liposarcoma subtypes to chemotherapy. In: European Journal of Cancer...

Riebold et al.: A C-terminal HSP90 inhibitor restores glucocorticoid sensitivity and relieves a mouse allograft model of Cushing disease. In: Nature Medicine...

Sabel: Assessing spatial vision – automated measurement of the contrast-sensitivity function in the hooded rat. In: Journal of Neuroscience Methods. Band 97...

vereinigt. In C dürfen Funktionen nicht verschachtelt definiert werden. Case sensitivity Im Gegensatz zu C ist Pascal in Bezug auf Schlüsselwörter, Bezeichner...

Hutchinson, Richard D. Pancost: Global mean surface temperature and climate sensitivity of the early Eocene Climatic Optimum (EECO), Paleocene–Eocene Thermal...

Abgerufen im 1. Januar 1  H. A. Kues, J. C. Monahan et al.: Increased sensitivity of the non-human primate eye to microwave radiation following ophthalmic...

Gabler Banklexikon. Springer Gabler, abgerufen am 25. April 2026.  Price Sensitivity (Basis Point Value). (PDF; 462 KB) ICE Futures Europe, 2014, abgerufen...

T'Sjoen, R. Vlietinck, P. B. Hoebeke: Male circumcision decreases penile sensitivity as measured in a large cohort. In: BJU international. Band 111, Nummer...

Heinrich Scheiblauer, Angela Filomena, Andreas Nitsche et al.: Comparative sensitivity evaluation for 122 CE-marked rapid diagnostic tests for SARS-CoV-2 antigen...

Aphrodita aculeata. Sea mouse. Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme, Plymouth: Marine Biological Association...

Bilgin, R. Bondü, B. Elsner: Longitudinal associations between justice sensitivity, nonsuicidal self-injury, substance use, and victimization by peers....

S. 69. Xiao-Fang Jin, Zhong-Ming Ye, Grace M. Amboka et al.: Stigma Sensitivity and the Duration of Temporary Closure Are Affected by Pollinator Identity...

abgerufen am 30. Oktober 2022]).  Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: PNAS. 110...

supplementation improves endothelial function and ameliorates insulin sensitivity and inflammation in cardiopathic nondiabetic patients after an aortocoronary...

other cave-dwelling urodele species). Review and new results on light-sensitivity and non-visual orientation in subterranean urodeles (Amphibia). In: Animal...

M. Kojima, I. Yamamoto et al.: Gradations of clinical severity and sensitivity to change assessed with the Beck Depression Inventory-II in Japanese...

Publishing Jägerstedt Publishing Lisa Langseth Alex Haridi 11 3 Der Sensitivity Consultant Sensitivitetskonsulten Lisa Langseth Maria Nygren 12 4 Literatur...

Orientations in Depression: an analysis of Validation seeking and rejection sensitivity in a Community sample of Young adults. 2014, PMID 24575914.  Smith et...

providing monofocal-like distance visual quality or provide contrast sensitivity that is significantly poorer than with monofocal IOLs.“  Joaquín Fernández...

Spangenberg, T. Turanyi (1982): An Extended Kinetic Model and its Reduction by Sensitivity Analysis for the Methanol//Oxygen Gas-Phase Thermolysis. In: Acta Chimica...

PMID 29071065, PMC 5639933 (freier Volltext).  R A Romero, T B Sutton: Sensitivity of Mycosphaerella fijiensis, causal agent of black sigatoka of banana...

PMID 20206115. Fabrizio Gentile, Ernesto Bali, Giuseppe Pignalosa: Sensitivity and applications of the nondenaturing staining of proteins on polyvinylidene...

bildet das Prinzip der abnehmenden Sensitivität (englisch diminishing sensitivity) ab. Da die Wertfunktion im Verlustbereich steiler als im Gewinnbereich...

Gruppendynamischen Trainings auf der Selbsterfahrung, spricht man von Sensitivity-Training, wo es verstärkt um Gespür, Feinfühligkeit, Einfühlungs- und...

Data Center, Boulder (Colorado) (englisch) Seda Yolsal, Tuncay Taymaz: Sensitivity Analysis on Relations Between Earthquake Source Rupture Parameters and...

controlling glucose tolerance in man: measurement of insulin sensitivity and beta-cell glucose sensitivity from the response to intravenous glucose. In: The Journal...

Rahmani, JH. Haseman, GT. Lemmel, S. Kaster, JS. Buckley: Relative sensitivity of colonoscopy and barium enema for detection of colorectal cancer in...

Beispiele sind der Fowler-Test, der Lüscher-Test und der Short Increment Sensitivity Index (SISI-Test). Diese Tests haben durch Hirnstammaudiometrie (FAP...

am 26. Februar 2021 (englisch).  J.-C. Liou, Nicholas L. Johnson: A sensitivity study of the effectiveness of active debris removal in LEO. In: Acta...

[…] Kapur’s direction has a lavish, sinister energy, tempered by a sensitivity to the potential silliness of a film which puts a legion of British character...

15;852:158457, PMID 36063955. Sandra B. Grauwiler, Jürgen Drewe, André Scholer: Sensitivity and Specificity of Urinary Cannabinoid Detection with Two Immunoassays...

(researchgate.net).  Stewart S. H., Peterson J. B., Pihl R. O.: Anxiety sensitivity and self-reported alcohol consumption rates in university women. In:...

Incredible (Nocturnal Groove) 2006: If In Doubt Go Out (Positiva) 2006: Sensitivity feat. Chic (Positiva) 2007: Pusher (Positiva) 2007: New Day (Positiva)...

frequency interference-free dedicated lunar far side crater for high sensitivity radioastronomy. Acta Astronautica, Vol. 46, Issue 8, 1. April 2000, S...

Eleanor J. Burke, Charles D. Koven: A spatial emergent constraint on the sensitivity of soil carbon turnover to global warming. In: Nature Communications...

Albrecht: Effect of pentosan polysulfate therapy on intravesical potassium sensitivity. In: Urology. 59. Jahrgang, Nr. 3, 2002, S. 329–333, doi:10.1016/s0090-4295(01)01586-2...

ECS Equilibrium Climate Sensitivity Gleichgewichtsklimasensitivität EHS Emissionshandelssystem EITE emisson-intensive und trade exposed emissionsintensive...

Clarkin: A Multisurface Interpersonal Circumplex Assessment of Rejection Sensitivity. In: Journal of Personality Assessment. 99. Jahrgang, Nr. 1, 2. Januar...

(2), 2006, S. 1260–1268 Matthew J. Mason und Peter M. Narins: Seismic sensitivity in the Desert golden mole (Eremitalpa granti): A review. Journal of Comparative...

KM. Meurs (2008): Breed distribution of the ABCB1-1Delta (multidrug sensitivity) polymorphism among dogs undergoing ABCB1 genotyping. In: JAVMA 233(6):921-4...

eja.2009.06.004.  Tuomas Tall, Pere Puigbò: Rethinking the Intrinsic Sensitivity of Fungi to Glyphosate. In: Biotech (Basel (Switzerland)). Band 11, Nr...

D. Jones, Y. Wan, B. Collins, J. L. Newsted, D. Kay, S. J. Bursian: Sensitivity of Japanese quail (Coturnix japonica), Common pheasant (Phasianus colchicus)...

Internet Archive)  Tilmes, S., Müller, R., & Salawitch, R. (2008). The sensitivity of polar ozone depletion to proposed geoengineering schemes. Science...

Ralf Schulz, Elena A. Rozhkova: Titanium Dioxide Nanoparticles Increase Sensitivity in the Next Generation of the Water Flea Daphnia magna. In: PLoS ONE...

Church, Julian C. Partridge: Behavioural investigation of polarisation sensitivity in the Japanese quail (Coturnix coturnix japonica) and the European starling...

Climate Model with Seasonal Variation for Future Studies of Climate Sensitivity. In: Dynamics of Atmospheres and Oceans 3, 1979, S. 393–426 J. D. Hays...

E. Kolattukudy: Biosynthetic pathways of cutin and waxes, and their sensitivity to environmental stresses. In: G. Kerstiens (Hrsg.): Plant Cuticles....

pyridoxin-dependent. In: Online Mendelian Inheritance in Man. (englisch). Alcohol sensitivity. In: Online Mendelian Inheritance in Man. (englisch)....

Unterscheidet Kennschalldruckpegel und Wirkungsgrad bei passiven Lautsprechern (sensitivity & efficiency) Visaton SC 5 Fostex FW800HS SMSG50 von Ascendo mit Sitz...

84 % der Limonaden und Cola in Dosen mit Bisphenol A belastet. Chemical Sensitivity Network, 6. März 2009, abgerufen am 17. September 2013.  Carsten Dierig:...

Habitats in the Ozark Highlands of Missouri: Assessment of Physical Habitat Sensitivity to Environmental Change. United States Geological Survey – Biological...

des gruppendynamischen Trainings ist die T-Gruppe (im engl. auch als sensitivity training group bezeichnet). In der T-Gruppe arbeiten 7–15 Teilnehmer...

 November 2020.  C.Q. Zhang, Y.H. Liu, H.M. Wu, B.C. Xu, P.L. Sun: Baseline sensitivity of Pestalotiopsis microspora, which causes black spot disease on Chinese...

Ralf Reski (1995) Gelrite and agar differently influence cytokinin-sensitivity of a moss. Journal of Plant Physiology 146, 369–371. Eckhard Bast: Mikrobiologische...

Jonathan LaRiviere, Ana Christina Ravelo: High Earth-system climate sensitivity determined from Pliocene carbon dioxide concentrations. In: Nature Geoscience...

Assessment sensitivity (unveröffentlicht): S. 78, online (PDF; 1,2 MB). Assessment sinsitivity (unveröffentlicht): S. 35–37. Assessment sensitivity (unveröffentlicht):...

klein. Die Bezeichnung S bezieht sich auf die höhere Empfindlichkeit (sensitivity) der Kamerasensoren unter Verzicht auf höhere Auflösung. Diese Kamera...

978-3-943365-76-4 (deutsch) Love and Ethnology. The Colonial Dialectic of Sensitivity (after Hubert Fichte) / Liebe und Ethnologie. Die koloniale Dialektik...

2001, S. 76, doi:10.1046/j.1365-2664.2001.00569.x. J. C. McIlroy: The Sensitivity of Australian Animals to 1080 Poison 11. Marsupial and Eutherian Carnivores...

an der Columbia University). doi:10.2172/12131479 Sensitivity and Uncertainty Analysis Sensitivity and Uncertainty Analysis. Volume 1: Theory. Chapman...

Urinary House Soiling (Periuria) in Cats and Its Differentiation: The Sensitivity and Specificity of Common Diagnostic Signs. In: Front Vet Sci 5, 2018...

E. Mains, C. Fernyhough, E. Fradley, M. Tuckey: Rethinking maternal sensitivity: Mothers’ comments on infants mental processes predict security of attachment...

Arrays. MathWorks, abgerufen am 3. Mai 2026 (englisch).  Case and Space Sensitivity. MathWorks, archiviert vom Original (nicht mehr online verfügbar) am...

consumption improves fat-free mass, plasma HDL-cholesterol and insulin sensitivity in healthy men with normal BMI compared to peanut oil. In: Clinical Nutrition...

Interest. Oxford University Press 2005. John MacFarlane: The Assessment Sensitivity of Knowledge Attributions. Oxford Studies in Epistemology 1 (2005), S...

1073/pnas.0812721106 (englisch).  Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: pnas. 110...

with minimal vibrato, her natural declamation, agile coloratura and her sensitivity to words have been widely admired by interpreters of early, Renaissance...

Accelerating changes in ice mass within Greenland, and the ice sheet’s sensitivity to atmospheric forcing. Proceedings of the National Academy of Sciences...

Scholz, Ralf Reski: Gelrite and agar differently influence cytokinin-sensitivity of a moss. In: Journal of Plant Physiology. Bd. 146, 1995, S. 369–371...

(wiley.com [abgerufen am 18. Mai 2025]).  V. Franco, S. Oparil: Salt sensitivity, a determinant of blood pressure, cardiovascular disease and survival...

Nelson, Jonathan D. Buckley, Rebecca L. Thomson et al.: Diagnostic sensitivity of 2-day cardiopulmonary exercise testing in Myalgic Encephalomyelitis/Chronic...

heute als Pionierin gilt, und prägte den Begriff Sensory Processing Sensitivity (SPS). Nach einer Operation 1987, die sie emotional aufwühlte, wurde...

3165), increase in lean body mass (ID 498, 731), increase in insulin sensitivity (ID 1517), protection of DNA, proteins and lipids from oxidative damage...

  James Hansen, Makiko Sato, Gary Russell, Pushker Kharecha: Climate sensitivity, sea level and atmospheric carbon dioxide. In: Philosophical Transactions...

Markus Winterberg, Nicholas PJ Day, Joel Tarning, Daniel Blessborn: High sensitivity methods to quantify chloroquine and its metabolite in human blood samples...

abgerufen am 4. März 2011]).  Mark E Daly: Acute effects on insulin sensitivity and diurnal metabolic profiles of a high-sucrose compared with a high...

unterschiedlich bewertet wird. Das Umweltbundesamt definiert einen Noise Sensitivity Depreciation Index (NSDI) mit 0,87 % je dB(A) als Ergebnis einer Auswertung...

(2001) 248(6), S. 469–477. (Review) PMID 11499636 F. Focher u. a.: Sensitivity of monkey B virus (Cercopithecine herpesvirus 1) to antiviral drugs:...

Kontrastempfindungsfunktion (Contrast Sensitivity Function, CSF) über der Ortsfrequenz in Linienpaaren pro Bildhöhe...

und COSMO-ART, auf dwd.de Modeling of gas and aerosol with WRF/Chem over Europe: Evaluation and sensitivity study, auf agupubs.onlinelibrary.wiley.com...

ISBN 3-13-140543-0. Martin S. Angst, Nicholas G. Phillips et al.: Pain sensitivity and opioid analgesia: a pharmacogenomic twin study. In: Pain. 2012. doi:10...

José Pedro Friedmann Angeli, Marcus Conrad: ACSL4 dictates ferroptosis sensitivity by shaping cellular lipid composition. In: Nature Chemical Biology. Band 13...

back-illuminated CMOS image sensor, realizing high picture quality, nearly twofold sensitivity(*1) and low noise. In: sony.com. 11. Juni 2008, abgerufen am 19. Februar...

Band 67, 1998, S. 135–152. mit M. Ehrendorfer, A. Haslinger: Climate Sensitivity of Snow Cover Duration in Austria, International Journal of Climatology...

Phone Base Station Signals Increase Symptoms in Individuals Who Report Sensitivity to Electromagnetic Fields? A Double-Blind Randomized Provocation Study...

abundance double quantum transfer spectroscopy) 13C-ADEQUAT (adequate sensitivity double quantum transfer spectroscopy) 1D/2D-DOSY (diffusion ordered spectroscopy)...

Abgerufen am 22. Januar 2025 (englisch).  Belek: Articulating Sensory Sensitivity: From Bodies with Autism to Autistic Bodies. In: Medical Anthropology...

Abgerufen am 9. Januar 2018.  D. R. Griffin, A. Novick, M. Kornfield: The sensitivity of echolocation in the fruit bat, rousettus. In: The Biological Bulletin...

G. Filler, F. Priem, I. Vollmer, J. Gellermann, K. Jung: Diagnostic sensitivity of serum cystatin for impaired glomerular filtration rate. In: Pediatric...

is a heartfelt drama that honors its delicate themes with bravery and sensitivity.) Bei Metacritic erhält der Film eine Bewertung von 72/100, basierend...

(auch Richtig-positiv-Rate, Empfindlichkeit oder Trefferquote; englisch sensitivity, true positive rate, recall oder hit rate) gibt die Wahrscheinlichkeit...

 123 (englisch, google.com).  Kaplan, Harold I.; Benjamin J. Sadock: Sensitivity through encounter and marathon. In: Modern Group Book. Band 4. J. Aronson...

recruits“ – Cox, Eva Luna, S. 78. „macho code“ – Cox, Eva Luna, S. 84. „sensitivity despite his hard exterior“ – Cox, Eva Luna, S. 86. „sexist guerrilla“...

Keshavarz, Thomas M. Klapötke, The Properties of Energetic Materials - Sensitivity, Physical and Thermodynamic Properties, 2. Auflage, de Gruyter, Berlin...

Bruce Buffett, David Archer: Global inventory of methane clathrate: sensitivity to changes in the deep ocean. In: Earth and Planetary Science Letters...

The cannabinoid Δ(9)-tetrahydrocannabivarin (THCV) ameliorates insulin sensitivity in two mouse models of obesity. In: Nutrition & diabetes. Band 3, 2013...

John R. Britton, Helen L. Britton, Virginia Gronwaldt: Breastfeeding, Sensitivity, and Attachment. Pediatrics, Band 118, Heft 5, November 2006 (Abstract)...

Phosphocreatine Circuit: Molecular and Cellular Physiology of Creatine Kinases, Sensitivity to Free Radicals, and Enhancement by Creatine Supplementation. In: Valdur...

Imperial College London, Report 4. Neil M. Ferguson et al.: Relative sensitivity of international surveillance (PDF) (Memento vom 5. März 2020 im Internet...

Highsenser stellen die Geschwindigkeit bzw. die Genauigkeit (von engl. sensitivity) der Maus hoch ein und können daher in Ego-Shootern sehr schnell reagieren...

University 1974. Paul Werbos: Applications of advances in nonlinear sensitivity analysis. In: System modeling and optimization. Springer, Berlin/Heidelberg...

Behçet’s Disease (ICBD): a collaborative study of 27 countries on the sensitivity and specificity of the new criteria. In: Journal of the European Academy...

Schröder-Abé: Benefits of power posing: effects on dominance and social sensitivity. In: Comprehensive Results in Social Psychology. Band 2, Nr. 1, 2. Januar...

Topal, G. Gergely, A. Erdohegyi, G. Csibra, A. Miklosi: Differential Sensitivity to Human Communication in Dogs, Wolves, and Human Infants. In: Science...

Hebephilie in das DSM-5 von Karen Franklin James M. Cantor, Ian V. McPhail: Sensitivity and Specificity of the Phallometric Test for Hebephilia. In: The Journal...

Correlation between clinical findings and laboratory tests for alpha gal sensitivity. In: Annals of Allergy, Asthma & Immunology. Band 119, Nr. 5, November...

1073/pnas.0812721106 (englisch).  Richard E. Zeebe: Time-dependent climate sensitivity and the legacy of anthropogenic greenhouse gas emissions. In: PNAS. Band 110...

the Derivatives in Long Pepper Extract by HPLC Using Relative Molar Sensitivity. In: Food Hygiene and Safety Science (Shokuhin Eiseigaku Zasshi). Band 60...

höchster Punkt: Big Ben, Heard-Insel: 2745 m Miller, Gifford et al. Sensitivity of the Australian Monsoon to insolation and vegetation: Implications...

Frederick, Jorien E Vonk: Subsea permafrost carbon stocks and climate change sensitivity estimated by expert assessment. In: Environmental Research Letters. Band 15...

1810141115 James Hansen, Makiko Sato, Gary Russell, Pushker Kharecha: Climate sensitivity, sea level and atmospheric carbon dioxide. In: Philosophical Transansactions...

Jeffery: The spectral transmission of ocular media suggests ultraviolet sensitivity is widespread among mammals. In: Proc. R. Soc. B., 2014, S. 281(1780);...

Zeit nach dem Impuls. Diese zeitabhängige Verstärkungsregelung wird sensitivity time control genannt. Stärke des Echosignals: Diese hängt sowohl von...

J Hautus, Kauko Heikkilä: Elucidating the relationship between noise sensitivity and personality. In: Noise & Health. Band 17, Nr. 76, 2015, S. 165–171...

Michael R. Olson, Tomoaki Okuda, Kenneth A. Walz, James J. Schauer: Sensitivity of hazardous air pollutant emissions to the combustion of blends of petroleum...

(AgRuD)-Patientenberatungsstelle der Deutschen Gesellschaft Multiple-Chemical-Sensitivity (DGMCS) e.V. tätig. Bernd Lößner verstarb am 6. Februar 2014 im Alter...

Shimano H: Elovl6: a new player in fatty acid metabolism and insulin sensitivity. In: J Mol Med. 87. Jahrgang, Nr. 4, April 2009, S. 379–84, doi:10...

ATP5E F1ε 51 606153 20q13.3 ATP5O F1O 213 600828 21q22.1-22.2 Oligomycin sensitivity conferral protein ATP5F1 Fob 256 603270 1p13.2 ATP5G1 Foc Isoform 1 136...

Anne-Sophie Hacquin, Sacha Altay, Lene Aarøe, Hugo Mercier: Disgust sensitivity and public opinion on nuclear energy. In: Journal of Environmental Psychology...

Audiodateien Kennschalldruckpegel und Wirkungsgrad bei passiven Lautsprechern (sensitivity) Wirkungsgrad von Bühnenscheinwerfern Energetischer Wirkungsgrad – Erklärung...

researchgate.net).  Di You, Yukiko Maeda: Gender Differences in Moral Sensitivity: A Meta-Analysis. In: Ethics & Behavior. 21. Jahrgang, Nr. 4, 2011, S...

Staaten von Amerika“ und Svenska kyrkan „die schwedische Kirche“. Case sensitivity Binnenmajuskel Wiktionary: Kleinschreibung – Bedeutungserklärungen, Wortherkunft...

den wichtigsten Therapieformen zählen Basic Encounter von Carl Rogers, Sensitivity Training in der Gruppendynamik, Open Encounter von Will Schutz, Casriel-Therapie...

Tools with Age Correction and Weighting of Subtests According to Their Sensitivity and Specificity. In: Journal of Alzheimer’s Disease. 34, 2013, S. 813–834...

Olivier Gagliardini, Delphine Six, Guillaume Gastineau, Christian Vincent: Sensitivity of Glaciers in the European Alps to Anthropogenic Atmospheric Forcings:...

Luis Martinez: Purified palmitoleic acid for the reduction of high-sensitivity C-reactive protein and serum lipids: A double-blinded, randomized, placebo...

(Offizielle Website), abgerufen am 21. Januar 2013. Murray W. Johns: Sensitivity and specificity of the multiple sleep latency test (MSLT), the maintenance...

Kaitlyn E. Kortright, Deepak Narayan: Phage selection restores antibiotic sensitivity in MDR Pseudomonas aeruginosa. In: Scientific Reports. Band 6, 26. Mai...

3834818151 W. Rapp, J. Görres, M. Wiescher, H. Schatz, F. Käppeler: Sensitivity of p-Process Nucleosynthesis to Nuclear Reaction Rates in a 25 M☉ Supernova...

Goodworth: Sound Tolerance Conditions (Hyperacusis, Misophonia, Noise Sensitivity, and Phonophobia): Definitions and Clinical Management. In: American...

theology, philosophy, and literature, and with a commendable ecumenical sensitivity, Tück achieves in this insightful work a remarkable fusion of theology...

Nissim und Adam Davison Smith für ihren Aufsatz Calibrating Noise to Sensitivity in Private Data Analysis zu Differential Privacy 2018 Oded Regev für...

Meares-Irlen-Syndrom, auch Irlen-Syndrom, Visual Stress oder Scotopic Sensitivity Syndrome (skotopisches Sensitivitätssyndrom), werden visuelle Missempfindungen...

the homosexuality of a famous athlete, he was required to attend gay-sensitivity sessions and publish a piece of self-criticism in the student newspaper...

K. Bouman: An internet-based study on the relation between disgust sensitivity and emetophobia. In: Journal of Anxiety Disorders. 2008, 22(3), S. 524–531...

Wollnik: Seasonal variations in circadian rhythms coincide with a phase of sensitivity to short photoperiods in the European hamster. In: Journal of Comparative...

104 Emotional Intelligence (1995), S. 104; Robert Rosenthal et al.: Sensitivity to Nonverbal Communication: The PONS Test, The Johns Hopkins University...

abgerufen am 20. Februar 2011 (englisch).  M Matsuda, RA DeFronzo: Insulin sensitivity indices obtained from oral glucose tolerance testing: comparison with...

mirabegron treatment increases human brown fat, HDL cholesterol, and insulin sensitivity. In: Journal of Clinical Investigation. Band 130, Nr. 5, 23. März 2020...

Outcome = Lebensqualität McMaster University (PICO) Agoritsas T et al.: Sensitivity and predictive value of 15 PubMed search strategies to answer clinical...

276, 2015, S. 900–914 Matthew J. Mason und Peter M. Narins: Seismic sensitivity in the Desert golden mole (Eremitalpa granti): A review. Journal of Comparative...

NOX4-dependent neuronal autotoxicity and BBB breakdown explain the superior sensitivity of the brain to ischemic damage. In: Proceedings of the National Academy...

bestimmte) Kirche gelten keine einheitlichen Regeln. Binnenmajuskel Case sensitivity Brigitte Labs-Ehlert: Versalschreibung in althochdeutschen Sprachdenkmälern...

Efrat Dener, Alex Kacelnik und Hagai Shemesh: Pea Plants Show Risk Sensitivity. In: Current Biology. Band 26, Nr. 13, 2016, S. 1763–1767, doi:10.1016/j...

Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. 584. Jahrgang, Nr. 7822, August 2020, S. 569–573...

September 2014, C. Lange J. Majlesi, H. Togay, H. Unalan, S. Toprak: The sensitivity and specificity of the Slump and the Straight Leg Raising tests in patients...

J. Borge, J. Dubochet: Cryo-negative staining reduces electron-beam sensitivity of vitrified biological particles, in: Journal of Structural Biology...

PMID 18628146. R. Matsuo: Role of saliva in the maintenance of taste sensitivity. In: Critical Reviews in Oral Biology and Medicine. Band 11, Nummer 2...

haben sie dafür den Begriff der mütterlichen Feinfühligkeit (maternal sensitivity) übernommen: Die Frau richtet ihre Aufmerksamkeit ganz aufs Kind („Babyreading“)...

Fotokinoverlag, Leipzig 1974, S. 74–75.  Tadaaki Tani: Photographic Sensitivity: Theory and Mechanisms. Oxford University Press, New York 1995, ISBN...

Grant, E. Nastouli, C. A. Foy, J. F. Huggett: Comparative study of sensitivity, linearity, and resistance to inhibition of digital and nondigital polymerase...

Oktober 2023, abgerufen am 10. Oktober 2023. Albatross movement suggests sensitivity to infrasound cues at sea pnas.org, 9. Oktober 2023, abgerufen am 10...

delight, because it deals with issues of growing up, like identity and the desire to fit in, with depth and sensitivity and in utterly beautiful verse.«...

(Laudatio). The LIGO Scientific Collaboration: Exploring the sensitivity of next generation gravitational wave detectors, Classical and Quantum...

new meat substitute, UPI, April 7, 2020 S. J. Katona, E. R. Kaminski: Sensitivity to Quorn mycoprotein (Fusarium venenatum) in a mould allergic patient...

on visual acuity, refractive error, corneal topography and contrast sensitivity. In: Eye & contact lens. 34, 4, 2008, S. 224–248. Kojima, Hasegawa, Hara...

verstärkten Effekten mit niedriger Dosisleistung (engl. enhanced low dose rate sensitivity, ELDRS), Neutronen- und Protonenverschiebungsschäden und Einzelereigniseffekten...

Soccer League, höchste Spielklasse im südafrikanischen Fußball Process Sensitivity Level, Maß der Elektronik zur Empfindlichkeit eines Bauteils Process...

orientation and navigation of juvenile alligators: evidence of magnetic sensitivity. In: Journal of Comparative Physiology A. Band 154, Nr. 5, 1984, S. 649–658...

oder Organisationslaboratorium Selbsterfahrungsgruppe Encounter-Gruppe Sensitivity-Gruppe TZI-Gruppe Therapeutische Gemeinschaft nach S. H. Foulkes, Wilfred...

Transportmittel 2012. Braunschweig 2012. mit M. Wimmershof, C. Klas, A. Zlocki: Sensitivity analysis for model based fusion of camera systems with navigation data...

Epidemische Neuromyasthenie, Fibromyalgie (Fibrositis), Multiple Chemical Sensitivity, Chronisches Fatigue-Syndrom. Die Einordnung des Chronischen Fatigue-Syndroms...

Crowell, David Tang, Eddie Harmon-Jones, Brandon J. Schmeichel: Disgust sensitivity predicts defensive responding to mortality salience. In: Emotion. Band 15...

J. McMurray, H. Dargie: A Comparison of the Reproducibility and the Sensitivity to Change of Visual Analogue Scales, Borg Scales, and Likert Scales in...

who have taken it gallantly. […] William Wyler has directed with a sensitivity that rarely shows in films. […] every one in the cast […] are excellent...

Seminar. 1992, S. 539. T. Kuwahara, T. Kohno, C. H. Wang: Static Electric Sensitivity Characteristics of Zr/BaCrO4, Pyrolants. In: Prop., Explos., Pyrotech...

durch die Kontrastempfindlichkeitsfunktion beschrieben (CSF = Contrast Sensitivity Function). Das menschliche Auge ist bei rund 200 Linienpaare pro Bildbreite...

Tonaderspeisung. Die Anschlussimpedanz beträgt etwa 310 Ohm. Die Empfindlichkeit (Sensitivity) liegt bei 1 kHz bei −56,0 dBV/Pa (1,60 mV/Pa); der zulässige maximale...

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

P. Dopfer, D. L. Wiest, L. A. Turka, W. W. Schamel, E. Palmer: High-sensitivity detection and quantitative analysis of native protein-protein interactions...

E. Grim, N. S. Fineberg: Definitions and characteristics of sodium sensitivity and blood pressure resistance. In: Hypertension, Band 8, Supl. II, 1986...

Objekts wird als Kontrastempfindlichkeitsfunktion (englisch Contrast Sensitivity Function (CSF)) angegeben. Sie ist das Produkt aus der rein optischen...

Hawkins, R. Seed: Biogenic Reefs (volume IX). An overview of dynamic and sensitivity characteristics for conservation management of marine SACs. Scottish...

Fehleinschätzung (political bias) und die Fehleinschätzung durch Sensitivität (sensitivity bias) bzw. die soziale Erwünschtheit als Hauptursachen fehlerhafter Ergebnisse...

Straight-in Direktanflug (zur Landung) S Standby Reserve, Bereitschaft S Sensitivity Level   (S) Summer Time Sommerzeit SA Selective Availability künstlich...

Patterson: Dietary Fat and Carbohydrates Differentially Alter Insulin Sensitivity During Caloric Restriction. In: Gastroenterology. Band 136, Nr. 5, 1...

promoviert wurde mit einer Arbeit über Gravitationswellendetektoren (Sensitivity and noise analysis of 4 km laser interferometric gravitational wave antennae)...

wissenschaft-online.de/abo/lexikon/biok/1508. K.M. Dorries et al. (1997). Sensitivity and behavioral responses to the pheromone androstenone are not mediated...

In: Z. Naturforsch. Nr. 34a, 1979, S. 163–166. Clifford R. Bowers: Sensitivity Enhancement Utilizing Parahydrogen. In: eMagRes. John Wiley & Sons, Ltd...

Zhang, 2021: The Earth’s Energy Budget, Climate Feedbacks, and Climate Sensitivity. In Climate Change 2021: The Physical Science Basis. Contribution of...

officinalis (Coral Weed). In: Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme (MarLIN). Abgerufen am 20. Mai 2008.  Hayward...

B. Buffet, D. Archer (2004): Global inventory of methane clathrate: sensitivity to changes in the deep ocean, in: Earth and Planetary Science Letters...

Environmental impacts of lighting technologies — Life cycle assessment and sensitivity analysis. In: Environmental Impact Assessment Review. Band 31, 2011,...

Hummel zu Gegen die Angst Podcast Stichwort Drehbuch mit Robert Hummel zu Sensitivity-Beratung https://www.filmstoffentwicklung.de/2016/gaeste/robert-hummel/...

US4419600: Stress-compensated quartz resonators.‌ Patent US5686779: High sensitivity temperature sensor and sensor array.‌ Y Cut Crystal (Memento vom 30....

Der High-sensitivity Solar Ultraviolet Spectroscopic Satellite, kurz Solar-C, ist ein geplantes Weltraumteleskop zur Sonnenbeobachtung, das von der japanischen...

2023.  (PDF; 8 kB). Tsuboi, T.; Hirano, Y.; Shibata, Y.; Motomizu, S.: Sensitivity Improvement of Ammonia Determination Based on Flow-Injection Indophenol...

Modifikation des Temperamentsmodells von Eysenck bekannt (Reinforcement Sensitivity Theorie). In diesem Zusammenhang arbeitete er an dem Verhaltensaktivierungssystem...

Yamamoto, C. C. Yancey, H. Yu, L. Zhang, M. E. Zucker, J. Zweizig: Sensitivity of the Advanced LIGO detectors at the beginning of gravitational wave...

marlin.ac.uk. Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme (on-line). Plymouth: Marine Biological...

Improves Night Vision: A Case Study of Dark Adaptometry and Scotopic Sensitivity in Kif Smokers of the Rifmountains of Northern Morocco. In: Journal of...

simple mathematical model supporting fast in-vivo estimation of insulin sensitivity and beta cell function. In: Scientific Reports. Band 12, Nr. 1, 21. Oktober...

B. T. Werner: Nonlinear dynamics of ice-wedge networks and resulting sensitivity. In: Nature. Band 417, 2002, S. 929–932. ( online (Memento vom 18. Oktober...

erreichte Power, wenn α, Stichprobengröße und Effektgröße vorgegeben sind, "Sensitivity": Berechnet die Effektgröße, wenn α, Power und Stichprobengröße vorgegeben...

angiotensin II and nitric oxide on the afferent arteriole influence sensitivity of the tubuloglomerular feedback. In: Frontiers in Physiology. Band 4...

Julia Brugger, Matthias Hofmann, Stefan Petri, Georg Feulner: On the Sensitivity of the Devonian Climate to Continental Configuration, Vegetation Cover...

Landwirtschaftsverlag 1984 Hannah M. Moir et al.: Extremely high frequency sensitivity in a ‘simple’ ear. In: Biology Letters. Band 9, Nr. 4, 2013, doi:10.1098/rsbl...

Jüdischer Verlag, 1982, ISBN 3-7610-0370-6, S. 614f. David Flusser: A new Sensitivity in Judaism and the Christian Message. Harvard Theological Review 61/1968...

the Human Hookworm Necator Americanus: Evaluating Immunity and Gluten-sensitivity - Full Text View - ClinicalTrials.gov. Abgerufen am 12. April 2022 (englisch)...

S. 1016–1018, PMID 18080352. K. Manavi, H. Young, A. McMillan: The sensitivity of syphilis assays in detecting different stages of early syphilis. In:...

Der SISI-Test (Short Increment Sensitivity Index) ist eine audiometrische Methode der Hals-Nasen-Ohrenheilkunde, mit der die Erkennbarkeit kleiner...

Kusche-Vihrog, Hans Oberleithner: An emerging concept of vascular salt sensitivity. In: F1000 Biology Reports. Band 4, 2. Oktober 2012, doi:10.3410/B4-20...

for free kappa and free lambda immunoglobulin light chains: relative sensitivity for detection of monoclonal light chains. In: Clinical Chemistry. 48...

et al.: Global warming under old and new scenarios using IPCC climate sensitivity range estimates. In: Nature Climate Change. Band 2, 2012, S. 248–253...

for free kappa and free lambda immunoglobulin light chains: relative sensitivity for detection of monoclonal light chains. In: Clinical Chemistry. 48...

Nestler: Expression of the transcription factor ΔFosB in the brain controls sensitivity to cocaine. In: Nature. Band 401, Nr. 6750, 1999, S. 272–276, doi:10...

Produzent (Executive Producer) 2004: Terry Tate, Office Linebacker: Sensitivity Training 2021: Red Notice Rawson Marshall Thurber bei IMDb Interview...

Dwork, Frank McSherry, Kobbi Nissim, Adam Smith: Calibrating Noise to Sensitivity in Private Data Analysis. In: Shai Halevi, Tal Rabin (Hrsg.): Theory...

Accumulation–Serial Fragmentation (PASEF): Multiplying Sequencing Speed and Sensitivity by Synchronized Scans in a Trapped Ion Mobility Device. In: Journal of...

pdf, 10,9 MB Direct neutrino-mass measurement with sub-electronvolt sensitivity, Nature, 14. Februar 2022 [1] First constraints on general neutrino interactions...

Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. Band 584, Nr. 7822, August 2020, S. 569–573, doi:10...

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

hatte er hauptsächlich in den USA Erfolg. Sein größter Solohit hieß Sensitivity und stieg Ende 1990 bis auf Platz 4 der US-Charts und Anfang 1991 auf...

of antinuclear autoantibodies of defined specificities. I. Precision, sensitivity, and specificity. In: Arthritis & Rheumatism. Band 42, Nr. 3, 1999, S...

activation of AMPK and results in improved glucose handling and insulin sensitivity. In: Journal of diabetes and metabolic disorders. Band 13, 2014, S. 51...

Thermococcus kodakaraensis Affects CO2/O2 Substrate Specificity and Oxygen Sensitivity. In: PLOS ONE 18. September 2015; doi:10.1371/journal.pone.0138351,...

with molecular masses 100,000–1000, and their detection with picomolar sensitivity. In: Electrophoresis. Band 12, Nummer 5, Mai 1991, S. 352–366, doi:10...

Wellerdieck, M. Kuczkowiak, G. Gisselmann, H. Hatt: Specificity and sensitivity of a human olfactory receptor functionally expressed in human embryonic...

1016/j.jhazmat.2017.05.040.  Dilip Badgujar, Mahadev Talawar: Thermal and Sensitivity Study of Dihydroxyl Ammonium 5,5′-Bistetrazole-1,1′-diolate (TKX-50)-based...

Petroleum & Coal, 56, 4, 2014, S. 407–417. Pezhman Kazemi, Roya Hamidi: Sensitivity Analysis of a Natural Gas Triethylene Glycol Dehydration Plant in Persian...

[abgerufen am 28. Dezember 2020]).  Chantal B.F. Vogels et al.: Analytical sensitivity and efficiency comparisons of SARS-COV-2 qRT-PCR primer-probe sets. medRxiv...

the Derivatives in Long Pepper Extract by HPLC Using Relative Molar Sensitivity. In: Food Hygiene and Safety Science (Shokuhin Eiseigaku Zasshi). Band 60...

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

von Cynthia Wilson. Robert S. Mayer: Strategies for Surviving Chemical Sensitivity. 2010, ISBN 978-0-578-05548-0 (englisch).  Offizielle Website von Chemical...

Schandry, C. Leopold, W. P. Oettinger, H. Berg, R. Kulzer, J. Tritschler: Sensitivity of humans to low-frequency magnetic fields. In: Proc. EMC '96. 1996....

Jeffrey Alan Gray (1982, 1987, 1990) unterscheidet nach der Reinforcement Sensitivity Theorie drei biologische Systeme, die das Verhalten steuern sollen: das...

: Effect of calorie restriction with or without exercise on insulin sensitivity, beta-cell function, fat cell size, and ectopic lipid in overweight subjects...

abgerufen am 19. März 2025.  10 terms related to race that require sensitivity in translation. Abgerufen am 19. März 2025 (englisch).  Übersetzer*innen...

promovierte. Ihre Dissertation trug den Titel: The factors that influence the sensitivity of the retina to color: A quantitative study and methods of standardizing...

Jörg König, Peter Stopfer, Martin F. Fromm: A Metabolomic Analysis of Sensitivity and Specificity of 23 Previously Proposed Biomarkers for Renal Transporter‐Mediated...

set graphs. In: Tomas Gal, Harvey J. Greenberg (Hrsg.): Advances in sensitivity analysis and parametric programming. (= International Series in Operations...

B. Otto, H. Viehoff et al.: Cereal Fiber Improves Whole-Body Insulin Sensitivity in Overweight and Obese Women. In: Diabetes Care. Band 29, Nr. 4, 2006...

vor dem Musikteil und ←[u ←[a ←[0m danach. Der englische Begriff case sensitivity beschreibt, wie ein System mit Groß- und Kleinschreibung umgeht. DOS...

that I am a Gianni Versace fanatic... His approach to design and his sensitivity to colour appeal to the dormant artist in me and somehow I feel that...

78 (2000), Heft 4, S. 240–242. M. N. Saridomichelakis u. a.: Relative sensitivity of hair pluckings and exudate microscopy for the diagnosis of canine...

Zeitschrift).  M. Sheik-bahae, A. A. Said, E. W. Van Stryland: High-sensitivity, single-beam n2 measurements. In: Optics Letters. Band 14, Nr. 17, 1...

Collaboration: Direct neutrino-mass measurement with sub-electronvolt sensitivity. In: Nature Physics. Band 18, Nr. 2, Februar 2022, ISSN 1745-2481, S...

32(1), 2003 Jan, S. 60–64. N. Hallab, K. Merritt, J. J. Jacobs: Metal sensitivity in patients with orthopedic implants. In: J Bone Joint Surg Am. 83-A(3)...

in cellular subsets of human peripheral blood mononuclear cells and sensitivity to CpG oligodeoxynucleotides. In: Journal of Immunology. Band 168, Nr...

Steven Reiss, Rolf A Peterson, David M Gursky, Richard J McNally: Anxiety sensitivity, anxiety frequency and the prediction of fearfulness. In: Behaviour Research...

@1@2Vorlage:Webachiv/IABot/olympus.de dpreview, Olympus E-30 review Olympus E-30 ISO Sensitivity / Noise levels Deutsche Olympus E-System-Webseite Offizielle Website...

Johnson feat. Chic Remixe von T Smoove, Gianni Bini und Paolo Martini 2006 Sensitivity Sound Advice — — — UK40 (3 Wo.)UK — — — Erstveröffentlichung: Juli 2006...

Cicero, G. Derosa u. a.: Red yeast rice improves lipid pattern, high-sensitivity C-reactive protein, and vascular remodeling parameters in moderately...

Programming, Reihe A. mit R. Y. Rubinstein: Discrete event systems: Sensitivity analysis and stochastic optimization by the score function method, Wiley...

Joseph A. Berry: Carbon isotopes and water use efficiency: sense and sensitivity. In: Oecologia. Band 155, Nr. 3, 2008, S. 441–454, doi:10.1007/s00442-007-0932-7...

energy buildings, Routledge, ISBN 9781315726434, doi Uncertainty and sensitivity analysis in building performance simulation for decision support and...

Solved in Two Pages, Quanta Magazine, 25. Juli 2019. Hao Huang, Induced subgraphs of hypercubes and a proof of the Sensitivity Conjecture, Arxiv 2019....

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

Bacharach in Israel teil. 2013 veröffentlichte sie ihr zweites Album Over Sensitivity. Dieses Album enthält ausschließlich Lieder auf Hebräisch. Im selben...

Jerker Jarsjö: Water Balance and Level Change of Lake Babati, Tanzania: Sensitivity to Hydroclimatic Forcings. (PDF) 5. Dezember 2016, S. 3–4, abgerufen...

Moser E, Roden M: Liver ATP synthesis is lower and relates to insulin sensitivity in patients with Type 2 Diabetes. In: Diabetes Care. Band 34, Nr. 2,...

(englisch).  Master Sgt. Ido Kaslasi, 23: A perfect mix of ‘roughness, sensitivity’. timesofisrael.com, abgerufen am 7. März 2025 (englisch).  Army says...

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

S. I. Candille u. a.: Human genetic variation altering anthrax toxin sensitivity. In: Proceedings of the National Academy of Sciences. Band 109, Nummer...

Gerät ausgelegt ist. Übertragungsfaktor – die Empfindlichkeit (engl.: Sensitivity), mit welcher der ↑ Schalldruck von Mikrofonen in elektrische Signalspannung...

Grechenig, H. Weghaupt, C. Vass und C. Skorpik: Tritan colour contrast sensitivity function in refractive multifocal intraocular lenses. In: British Journal...

17 eine EP ein und sang dabei die Stücke A Foolish Thing to Do und My Sensitivity. 1989 veröffentlichte er mit Brenda Holloway die das Duett On the Rebound...

sind deshalb sehr schwer zu unterdrücken. In der Praxis wird meist eine Sensitivity Time Control (STC) genutzt, um die meist im Nahbereich auftretenden Störungen...

1137–1154. C. W. Piccoli: Contrast-enhanced breast MRI: factors affecting sensitivity and specificity. In: Eur. Radiol. 7 Suppl 5, 1997, S. 281–288. P. H....

Robert C. Lacy und Sherwin WB (2018). Applicability and limitations of sensitivity analyses for wildlife management. Journal of Applied Ecology 55, 1430–1440...

Milton J. Bennett: A developmental approach to training for intercultural sensitivity. In: International Journal of Intercultural Relations. Nr. 10, 1986,...

Pitzer: The Relationship Between Blood Sample Volume and Diagnostic Sensitivity of Blood Culture for Typhoid and Paratyphoid Fever: A Systematic Review...

Angeboten werden unter anderem Kurse in Akrobatik, Kommunikations- und Sensitivity-Training. Mit diesen Workshops und eigenen Inszenierungen reist das FTM...

steer a slightly derivative course somewhere between Aztec Camera’s sensitivity and Big Country’s grandeur, with a touch of Simple Minds.“ (Ira A. Robbins)...

Barden, Ward C. Wheeler, James M. Carpenter (2013): Direct Optimization, Sensitivity Analysis, and the Evolution of the Hymenopteran Superfamilies. American...

Montagnani, A. D. Richardson: Global Convergence in the Temperature Sensitivity of Respiration at Ecosystem Level. In: Science. Band 329, 2010, S. 838–840...

5334128 D. M. McNair, L. F. Droppleman, R. C. Pillard: Differential sensitivity of two palmar sweat measures. In: Psychophysiology. Band 3, Nr. 3, Januar...

(freier Volltext). P. A. Jänne, N. Gray, J. Settleman: Factors underlying sensitivity of cancers to small-molecule kinase inhibitors. In: Nature Reviews Drug...

Using multiple observationally-based constraints to estimate climate sensitivity, Entwurf vom 30. Januar (PDF; 140 kB) (Memento vom 8. Juli 2011 im Internet...

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

does not appear to be impacted by Omicron; studies of the comparative sensitivity of Ag-RDTs are ongoing.“  SARS-CoV-2 Viral Mutations: Impact on COVID-19...

Hopf/Weingarten: Qualitative Sozialforschung (1979). Barney G. Glaser: Theoretical Sensitivity. Advances in the Methodology of Grounded Theory (1978). Anselm L. Strauss;...

Influence of metabolic control on splanchnic glucose uptake, insulin sensitivity, and the time required for glucose absorption in patients with type 1...

Heidelberg 1927 doi:10.1007/BF01863946 CD Calnan, GA Caron: Quinine Sensitivity. In: BMJ. 2. Jahrgang, Nr. 5269, 30. Dezember 1961, S. 1750–1752, doi:10...

Michael S. Turner, D. Moltz, J. Powell, N. Golubev: Results from a High-Sensitivity Search for Cosmic Axions. In: Physical Review Letters. Band 80, Nr. 10...

Steculorum, Jens C. Brüning: Neuronal control of peripheral insulin sensitivity and glucose metabolism. In: Nature Communications. Band 8, Nr. 1, 4. Mai...

wurden durch Beobachtung und Selbsterfahrung (Selbsterfahrungs-Gruppe, Sensitivity-Gruppe) die sonst übliche Trennung von Lehre, Forschung und Lernen durchbrochen...

7164/antibiotics.43.492. O. V. Tymchyk, B. P. Matseliukh, V. I. Lavrinchuk: Sensitivity of Streptomyces globisporus 3-1–a highly active producer of landomycin...

Yurchenko: Further study of CdWO4 crystal scintillators as detectors for high sensitivity experiments: Scintillation properties and pulse-shape discrimination...

Sicherheitsinteressen, sondern insbesondere um internationale Wohlfahrt. „Sensitivity-Interdependenz“ (Sensibilität) besagt, dass Staaten zunehmend empfindlicher...

1989: East-West Exchanges Between Universal Principles and Cultural Sensitivity“, Springer 2020, ISBN 978-3030458102, S. 94 ESWRA Award auf ESWRA-Webseite...

Epub 2001 Apr 17. Marisa Carrasco: Covert attention increases contrast sensitivity: psychophysical, neurophysiological and neuroimaging studies. In: Visual...

143–162 (2004) The influence of ocean gateways on climate. Numerical sensitivity studies on ocean circulation rearrangements. (PDF; 116 kB) Geophysical...

Für diesen Blog erhielt sie bei den Laadli Media Awards for Gender Sensitivity 2010–11 die Auszeichnung für den besten englischsprachigen Blog. Bereits...

Disentangling greenhouse warming and aerosol cooling to reveal Earth’s climate sensitivity. In: Nature Geoscience. Band 9, Nr. 4, 2016, S. 286. doi:10.1038/ngeo2670...

Rondanelli, Jens Olaf Pepke Pedersen: Deep time evidence for climate sensitivity increase with warming. In: Geophysical Research Letters. 43. Jahrgang...

Community Can Enter into a Relationship of Respect, Compassion, and Sensitivity (Harper One, 2017). How Can I Find God? The Famous and Not-So-Famous...

Products: Effects of Ionization Polarity and Mobile Phase Modifier on the Sensitivity. In: Journal of Food Science. Band 81, Nr. 10, Oktober 2016, PMID 27589022...

der 8.3-Konvention, wandelt Klein- in Großbuchstaben um (siehe Case sensitivity), löst auch den Joker * zu mehreren ? (z. B. *.ASM zu ????????.ASM) auf...

1126/science.225.4658.226.  A. Cogoli, A. Tschopp und P. Fuchs-Bislin: Cell Sensitivity to Gravity. In: Science. Band 225, Nr. 4658, 13. Juli 1984, S. 228–230...

gay men: An examination of internalized homonegativity and rejection sensitivity as potential mechanisms. In: Journal of Consulting and Clinical Psychology...

Service to Society 2019 IRI Medal New Protein Sequenator with Increased Sensitivity. In: Science. Band 207, 1980, S. 523 (mit M. W. Hunkapiller) A Microchemical...

Richard F. Kay und Matthew W. Colbert: Auditory Morphology and Hearing Sensitivity in Fossil New World Monkeys. The Anatomical Record 293, 2010, S. 1711–1721...

PMID 20222560. S. N. Hill, M. K. Hausbeck: Virulence and fungicide sensitivity of Phytophthora cactorum isolated from American ginseng gardens in Wisconsin...

Hanser, 2014, ISBN 978-3-446-42625-2, S. 387 ff.  P.G.J. Barten: Contrast sensitivity of the human eye and its effects on image quality. Hrsg.: Knegsel. HV...

Weizenecker, J. Borgert, B. Gleich: A simulation study on the resolution and sensitivity of magnetic particle imaging. In: Physics in Medicine and Biology. Band 52...

M. J. Monteiro, J. Z. Yeh, C. T. Bever: Inactivation gating and 4-AP sensitivity in human brain Kv1.4 potassium channel. In: Brain Res. Nr. 831, 1999...

modernen Theorie der Kleingruppenprozesse, dem Sensitivitäts-Training (Sensitivity training) und T-Gruppen (T-groups) wesentliche Impulse. Tannenbaum beschrieb...

Ludwig, F. Hofmann, M. Biel: A single histidine residue determines the pH sensitivity of the pacemaker channel HCN2. In: J Biol Chem. 276, 2001, S. 6313–6319...

Band 69, 1997, S. 1269 mit S. Camalet, T. Duke, F. Jülicher: Auditory sensitivity provided by self-tuned critical oscillations of hair cells, Proc. Nat...

Linguistic Society. Band 11, 1975, S. 188–199.  William A. Ladusaw: Polarity Sensitivity as Inherent Scope Relations. 1979.  Anke von Bergen, Karl von Bergen:...

Gregory J. Hakim, Christopher J. Poulsen: Glacial cooling and climate sensitivity revisited. In: Nature. 584. Jahrgang, Nr. 7822, August 2020, ISSN 1476-4687...

Akademie der Wissenschaften mit G. Möller: Quantitative studies of the sensitivity of normal and neoplastic mouse cells to the cytotoxic action of isoantibodies...

(2005). M Klingenspor, H Niggemann, G Heldmaier: Modulation of leptin sensitivity by short photoperiod acclimation in the Djungarian hamster, Phodopus...

Verlag, Stuttgart 1994. Norbert Israelewski: The relation of radiation sensitivity to pronuclear chromosome structure. I. Different radiation sensitivities...

Crangon allmanni. A shrimp. Marine Life Information Network: Biology and Sensitivity Key Information Sub-programme, 2009. (Online) Crangon allmani im Marine...

ergeben. Die zugehörigen Empfindlichkeitsleitwerte Sv (engl. speed value / sensitivity) (auch als logarithmische ASA-Grad bekannt) unterstützen bei der Berechnung...

Lynam, Steven Schapiro: Development Of Ego Stages And Intercultural Sensitivity Through Doctoral Study. Fielding Graduate University, USA, [2] Sharon...

Accelerating changes in ice mass within Greenland, and the ice sheet’s sensitivity to atmospheric forcing. In: PNAS. Band 116, Nr. 6, 22. Januar 2019, S...

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network, Biology and Sensitivity Key Information Reviews. Marine Biological Association of the United...

K. Lauenroth et al.: Regional Analysis of the Central Great Plains: Sensitivity to Climate Variability. In: BioScience, Band 41, Nummer 10, November...

oxidative phosphorylation. 8. Properties of a factor conferring oligomycin sensitivity on mitochondrial adenosine triphosphatase. In: The Journal of Biological...

www.et-gw.eu, 14 June 2022. Stefan Hild et al.: Pushing towards the ET sensitivity using ‘conventional’ technology. 24. November 2008, arxiv:0810.0604,...

doi:10.1016/j.acthis.2006.01.002, PMID 16542712. M. Bély, J. Makovitzky: Sensitivity and specificity of Congo red staining according to Romhányi. Comparison...

Zhang, 2021: The Earth’s Energy Budget, Climate Feedbacks, and Climate Sensitivity. In Climate Change 2021: The Physical Science Basis. Contribution of...

8917837. L. Fernandez, E. Maquiera u. a.: Baboon syndrome due to mercury sensitivity. In: Contact Dermatitis. Band 33, Nummer 1, Juli 1995, S. 56–57, PMID...

(2017): Evolution of Baffin Bay water masses and transports in a numerical sensitivity experiment under enhanced Greenland melt. In: Atmosphere–Ocean. Band 55...

set graphs. In: Tomas Gal, Harvey J. Greenberg (Hrsg.): Advances in sensitivity analysis and parametric programming. (= International Series in Operations...

Thermococcus kodakaraensis Affects CO2/O2 Substrate Specificity and Oxygen Sensitivity. In: PLOS ONE 18. September 2015; doi:10.1371/journal.pone.0138351,...

Rondanelli, Jens Olaf Pepke Pedersen: Deep time evidence for climate sensitivity increase with warming. In: Geophysical Research Letters. Band 43, Nr...

11999692 (englisch).  Mekler VM: A photochemical technique to enhance sensitivity of detection of fluorescence resonance energy transfer. In: Photochem...

B. G. Durie, D. S. Alberts, T. E. Moon: Quantitation of differential sensitivity of human-tumor stem cells to anticancer drugs. In: The New England Journal...

dispatches its pyrotechnics with ease, and weaves its melodies with sensitivity and assurance. The “Concerto funèbre”, also of its time, is much darker...

Remote Influences on the Heat Content of the Labrador Sea: An Adjoint Sensitivity Study. In: JGR Oceans, Band 123, Ausgabe 4, S. 2646–2667. DOI:10.1002/2018JC013774...

Naumann u. a.: Targeting aberrant PI3K/Akt activation by PI103 restores sensitivity to TRAIL-induced apoptosis in neuroblastoma. In: Clinical Cancer Research...

magazine, January/February 2001. “Race Experts: How Racial Etiquette, Sensitivity Training, and New Age Therapy Hijacked the Civil Rights Revolution,”...

auch zu einem bis heute verwendeten visuellen Test (Visual-Aesthetic-Sensitivity-Test, kurz VAST) führten, veröffentlichten Götz und Rissa 1972 in ihrem...

geehrt. James E. Hansen und Taro Takahashi: Climate Processes and Climate Sensitivity. In: Geophysical Monograph. Band 29, Nr. 5. American Geophysical Union...

 a.: Bandwidth and Fermi surface of iron oxypnictides: Covalency and sensitivity to structural changes, Phys. Rev. B, Band 78, 2008, S. 064518 mit M....

1990, S. 168.  Robert A. Hinde, R. Q. Bell, E. Steel: Changes in the sensitivity in the canary brood patch during the natural breeding season. In: Animal...

monocytes to cross the blood-brain barrier into the brain and the in vivo sensitivity of the blood-brain barrier to disruption by lipopolysaccharide. In: J...

2014, S. 371–96. Missionary Ethics in Q 10:2-12. In Kobus Kok et al.: Sensitivity to Outsiders: Exploring the Dynamic Relationship between Mission and...

Crescenzi, Giorgio Gambosi, Lucia Nasti, Aurora Rossi, Emanuele Natale: A sensitivity analysis of the Earth for all model: Getting the giant leap scenario...

in microfluid segments and microtoxicological determination of their sensitivity against CuCl2 in the nanoliter range, Eng. Life Sci. 11 (2022), 580-587...

MA, 1986. M.J. Loboda, T. E. Parker and G. K. Montress, "Temperature sensitivity of dielectric resonators and dielectric resonator oscillators," Proc...

Questionnaire (Munich ED-Quest) DSM-5/ICD-10: Validity, Reliability, Sensitivity to Change, and Norms. In: European Eating Disorder Review. Band 23, Nr...

Sepiola rondeletii. In: Marine Life Information Network: Biology and Sensitivity Key Information Reviews. H. Tyler-Walters, K. Hiscook, 6. November 2011...

(Abschnitt Systematik) Juliana Chacón, Susanne S. Renner: Assessing model sensitivity in ancestral area reconstruction using Lagrange: A case study using the...

D. H. Hellhammer: HPA axis reactivity and lymphocyte glucocorticoid sensitivity in fibromyalgia syndrome and chronic pelvic pain. In: Psychosom Med,...

Tigchelaar, Oliver Elison Timm, Andrey Ganopolski: Nonlinear climate sensitivity and its implications for future greenhouse warming. In: Science Advances...

et al.: The Einstein@home gamma-ray pulsar survey I - search methods, sensitivity and discovery of new young gamma-ray pulsars, 2016, arxiv:1611.01015...

Band 23, 2013, S. 1484–1490.  T. Mark Harrison und Axel K. Schmitt: High sensitivity mapping of Ti distributions in Hadean zircons. In: Earth and Planetary...

Nachweisgrenze liegt bei 1 Addukt auf 1010 N. Ramesh C. Gupta: Enhanced Sensitivity of 32P-Postlabeling Analysis of Aromatic Carcinogen: DNA Adducts. in:...

J. Steig, Qinghua Ding, E. Povl Abrahamsen, Michael Schröder: Strong Sensitivity of Pine Island Ice-Shelf Melting to Climatic Variability. In: Science...

Rocha, Jason A. Dunlop: Phylogenetic position of the acariform mites. Sensitivity to homology assessment under total evidence. In: BMC Evolutionary Biology...

cobitis Giant goby. In: Marine Life Information Network: Biology and Sensitivity Key Information Reviews. Abgerufen am 27. Februar 2020.  R. N. Gibson:...

Zhang, 2021: The Earth’s Energy Budget, Climate Feedbacks, and Climate Sensitivity. In Climate Change 2021: The Physical Science Basis. Contribution of...

Sortiment. Dabei ziehen sie auch externe Fachberater zu Rate oder setzen „Sensitivity Reader“ ein, die unsere Titel kritisch auf den richtigen Umgang mit sensiblen...

illnesses" : disease paradigm for chronic fatigue syndrome, multiple chemical sensitivity, fibromyalgia, post-traumatic stress disorder, Gulf War syndrome, and...

Jerker Jarsjö: Water Balance and Level Change of Lake Babati, Tanzania: Sensitivity to Hydroclimatic Forcings. (PDF) 5. Dezember 2016, S. 3, abgerufen am...

of our own day, but reveals an exquisite taste and the most delicate sensitivity qualities which are, perhaps, rather less characteristic of the present...

Newcombe-Experiment Luria, S. E., Delbrück, M.: Mutations of bacteria from virus sensitivity to virus resistance. In: Genetics. Band 28, Nummer 6, November 1943,...

18 (1): Article 2., 1938. mit M. S. Briscoe, Dewey E. Puckett: The Sensitivity to Antibiotics of Microorganisms Isolated from the Gut of "Blaberus caniifer"...

2003, S. 49–51.  OLG Düsseldorf, NStZ 1994, 43. Joan Dunayer: Fish: Sensitivity Beyond the Captor’s Grasp. In: The Animals’ Agenda. (Juli/August), 1991...

Tyler-Walters, K. Hiscock (Hrsg.): Marine Life Information Network: Biology and Sensitivity Key Information Reviews, Marine Biological Association of the United...