![Eddie Griffin (basketball)](https://upload.wikimedia.org/wikipedia/en/thumb/0/03/Eddie_Griffin_basketball_player.jpg/450px-Eddie_Griffin_basketball_player.jpg)
American basketball player (1982–2007) Eddie GriffinPersonal informationBorn(1982-05-30)May 30, 1982Philadelphia, Pennsylvania, U.S.DiedAugust 17, 2007(2007-08-17) (aged 25)Houston, Texas, U.S.NationalityAmericanListed height6 ft 10 in (2.08 m)Listed weight240 lb (109 kg)Career informationHigh schoolRoman Catholic(Philadelphia, Pennsylvania)CollegeSeton Hall (2000–2001)NBA draft2001: 1st round, 7th overall pickSelected by the New Jersey NetsPlaying career2001–…
![Recife Port](https://upload.wikimedia.org/wikipedia/commons/thumb/4/47/Porto_do_Recife_-_Recife_-_Pernambuco_-_Brasil.jpg/450px-Porto_do_Recife_-_Recife_-_Pernambuco_-_Brasil.jpg)
Port in Recife, Brazil Porto do Recife - Recife - Pernambuco - Brasil Recife Port is located in Recife Antigo in the city of Recife. This international port serves the RMR and has two main operational areas: cruises and cargo. It is located on the eastern island of Recife antigo on the banks of rivers Capibaribe and Beberibe. Differentiates itself from another ports located in the city center the fact that the port does not have any interferences with the center. Its administered by the Governme…
![Neue Osnabrücker Zeitung](https://upload.wikimedia.org/wikipedia/commons/thumb/1/10/Logo_NeueOZ_Wikipedia_700x151px_Sep2017.png/450px-Logo_NeueOZ_Wikipedia_700x151px_Sep2017.png)
Neue Osnabrücker Zeitungs logo. Tidningsskyltfönster för NOZ på gågata i Osnabrück. Neue Osnabrücker Zeitung (förkortas Neue OZ eller NOZ) är en tysk regional dagstidning i sydvästra Niedersachsen. Huvudredaktionen ligger i Osnabrück. Tidningen har sexdagarsutgivning, måndag–lördag, och hade inklusive alla lokala utgåvor en total såld upplaga på 159 511 exemplar under 2:a kvartalet 2016. Chefredaktör är sedan 2011 Ralf Geisenhanslüke. Historia Tidningen grundades 1967 g…
![Mediterranean grenadier](https://upload.wikimedia.org/wikipedia/commons/thumb/f/f1/Coryphaenoides_mediterraneus.jpg/450px-Coryphaenoides_mediterraneus.jpg)
Species of fish Mediterranean grenadier Conservation status Least Concern (IUCN 3.1)[1] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Actinopterygii Order: Gadiformes Family: Macrouridae Genus: Coryphaenoides Species: C. mediterraneus Binomial name Coryphaenoides mediterraneus(Giglioli, 1893) Synonyms[2] Chalinura mediterranea Giglioli, 1893 Chalinura murrayi europaea Nybelin, 1948 Coryphaenoides (Chalinura) mediterraneus Giglioli…
![Posiciones de los Países en los Juegos Centroamericanos y del Caribe](http://upload.wikimedia.org/wikipedia/commons/thumb/e/e7/Unofficial_flag_of_Guadeloupe_%28local%29.svg/450px-Unofficial_flag_of_Guadeloupe_%28local%29.svg.png)
En la tabla que se detalla a continuación, se presenta la posición en el medallero de cada país en cada una de las ediciones de los Juegos Centoamericanos y del Caribe. Los números de las posiciones en el país de la cuestión participó; los números de la posición subrayada indican que fue el país anfitrión. Si una casilla aparece en dorado, plateado, marrón o azul significa que ocupó la primera, segunda, tercera y cuarta posición, respectivamente. Las casillas con X, significa que e…
![Hamengkubuwana IX](http://upload.wikimedia.org/wikipedia/commons/thumb/3/38/Hamengkubawono_IX_Official_Portrait.jpg/450px-Hamengkubawono_IX_Official_Portrait.jpg)
Ingkang Sinuwun Sri SultanHamengkubuwana IXꦲꦩꦼꦁꦏꦸꦨꦸꦮꦤ꧇꧙꧇Sri Sultan Hamengkubuwana IXSultan Yogyakarta ke-9Mulai bertakhta18 Maret 1940 – 2 Oktober 1988PendahuluHamengkubuwana VIIIPenggantiHamengkubuwana XWakil Presiden Indonesia ke-2Masa jabatan23 Maret 1973 – 23 Maret 1978PresidenSoehartoPendahuluMohammad HattaPenggantiAdam MalikMenteri Koordinator Ekonomi, Keuangan, dan Industri Indonesia ke-1Masa jabatan25 Juli 1966 – 29 M…
![Tênis de mesa nos Jogos Pan-Americanos de 2023 - Qualificação](http://upload.wikimedia.org/wikipedia/commons/thumb/8/85/Table_tennis_pictogram.svg/450px-Table_tennis_pictogram.svg.png)
Ver artigo principal: Tênis de mesa nos Jogos Pan-Americanos de 2023 Tênis de mesa nosJogos Pan-Americanos de 2023 Simples masc fem Duplas masc fem mis Equipes masc fem Abaixo está o sistema de qualificação e os comitês olímpicos nacionais qualificados ao Tênis de mesa nos Jogos Pan-Americanos de 2023, programado para ser realizado em Santiago, no Chile, de 29 de outubro a 5 de novembro de 2023. Sistema de qualificação Um total de 88…
![أسيوط لتكرير البترول](http://upload.wikimedia.org/wikipedia/commons/thumb/f/fe/Flag_of_Egypt.svg/450px-Flag_of_Egypt.svg.png)
أسيوط لتكرير البترولأسيوط لتكرير البترولمعلومات عامةالجنسية مصر التأسيس 1984النوع قطاع عامالمقر الرئيسي جحدم، منفلوط، أسيوط، جمهورية مصر العربيةموقع الويب asorc.com المنظومة الاقتصاديةالشركة الأم الهيئة المصرية العامة للبترولالصناعة تكرير البترولمناطق الخدمة محافظات جمهور…
![بيوتر سويس](http://upload.wikimedia.org/wikipedia/commons/thumb/2/2e/Arrows-orphan.svg/450px-Arrows-orphan.svg.png)
هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (يناير 2018) بيوتر سويس معلومات شخصية الميلاد 10 سبتمبر 1971 (العمر 52 سنة)فوجسواف شلانسكي [لغات أخرى][1] الطول 1.87 م (6 قدم 1 1⁄2 بوصة) مركز اللعب وسط ا…
![Bahraini cricket team against Kuwait in Oman in 2022](http://upload.wikimedia.org/wikipedia/commons/thumb/2/2c/Flag_of_Bahrain.svg/450px-Flag_of_Bahrain.svg.png)
International cricket tour Bahrain cricket team against Kuwait in Oman in 2022 Bahrain KuwaitDates 11 – 17 August 2022Captains Sarfaraz Ali[n 1] Mohammed AslamTwenty20 International seriesResults Kuwait won the 5-match series 4–1Most runs Haider Butt (166) Ravija Sandaruwan (167)Most wickets Sathaiya Veerapathiran (9) Adnan Idrees (5)Sayed Monib (5)Player of the series Ravija Sandaruwan (Kuw) The Bahrain cricket team and Kuwait cricket team contested a five-match Tw…
![Expedition of Khalid ibn al-Walid (2nd Dumatul Jandal)](http://upload.wikimedia.org/wikipedia/en/thumb/9/99/Question_book-new.svg/450px-Question_book-new.svg.png)
Muslim military expedition to Dumatul Jandal in April 631 AD vteCampaigns of Muhammad Al-‘Īṣ Safwan Buwat Dhu al-'Ushairah Abwa' Badr Kudr Sawiq Banu Qaynuqa' Dhu 'Amar Bahran Uhud Hamra' al-Asad Banu Nadir Badr al-Maw'id Dhat ar-Riqa' 1st Daumat al-Jandal Trench Banu Qurayza al-Muraysi' Banu Lahyan Hudaybiyyah Fidak Khaybar 3rd Wadi al-Qurra' Mu'tah Mecca Hunayn Tabuk Autas Ta'if Further information: Military career of Muhammad Khalid ibn al-Walid invaded the city of Dumat Al-Jandal in Apr…
![Russia–United Arab Emirates relations](http://upload.wikimedia.org/wikipedia/commons/thumb/f/fd/Vladimir_Putin_in_the_United_Arab_Emirates_10_September_2007-5.jpg/450px-Vladimir_Putin_in_the_United_Arab_Emirates_10_September_2007-5.jpg)
Bilateral relationsRussia–United Arab Emirates relations Russia United Arab Emirates Diplomatic missionEmbassy of Russia, Abu DhabiEmbassy of the United Arab Emirates, Moscow UAE president Khalifa bin Zayed Al Nahyan with the Russian president Vladimir Putin on 10 September 2007. The relationship between the Russian Federation and the United Arab Emirates (UAE) stretches back to December 1971, when the Soviet Union and UAE broke off diplomatic relations. Relations between the two countries hav…
![Gyirmót FC Győr](http://upload.wikimedia.org/wikipedia/en/thumb/4/43/Gyirm%C3%B3t_FC_Gy%C5%91r_logo.png/450px-Gyirm%C3%B3t_FC_Gy%C5%91r_logo.png)
Hungarian football club Football clubGyirmótFull nameGyirmót Futball Club GyőrFounded1993; 30 years ago (1993)GroundMénfői úti StadionCapacity4,500ChairmanErnő HorváthManagerZsolt Tamási (caretaker)LeagueNB II2022–23NB II, 6th of 20WebsiteClub website Home colours Away colours Current season Gyirmót FC Győr is a Hungarian football club based in Gyirmót [ˈɟirmoːt], a suburb of Győr. The team currently plays in the second division (Nemzeti Bajnokság II)…
![Horizontal gene transfer](http://upload.wikimedia.org/wikipedia/commons/thumb/1/1b/Tree_Of_Life_%28with_horizontal_gene_transfer%29.svg/450px-Tree_Of_Life_%28with_horizontal_gene_transfer%29.svg.png)
Type of nonhereditary genetic change HGT redirects here. For other uses, see HGT (disambiguation). This article is about the natural process. For artificial gene transfer, see Gene delivery. Tree of life showing vertical and horizontal gene transfers Horizontal gene transfer (HGT) or lateral gene transfer (LGT)[1][2][3] is the movement of genetic material between organisms other than by the (vertical) transmission of DNA from parent to offspring (reproduction).[4]…
![TopSky](http://upload.wikimedia.org/wikipedia/en/thumb/9/99/Question_book-new.svg/450px-Question_book-new.svg.png)
This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article relies excessively on references to primary sources. Please improve this article by adding secondary or tertiary sources. Find sources: TopSky – news · newspapers · books · scholar · JSTOR (August 2011) (Learn how and when to remove this template message) This article's lead section contains…
![Outline of California](http://upload.wikimedia.org/wikipedia/commons/thumb/d/dd/Map_of_USA_CA.svg/450px-Map_of_USA_CA.svg.png)
Overview of and topical guide to California The flag of CaliforniaThe Great Seal of California The location of the state of California in the United States The following outline is provided as an overview of and topical guide to the U.S. state of California. California is the most populous and the third most extensive of the 50 states of the United States of America. California is home to Los Angeles, San Francisco, San Diego, and Sacramento, respectively the 2nd, 6th, 17th, and 23rd most populo…
![Half-Life: Blue Shift](http://upload.wikimedia.org/wikipedia/en/thumb/1/14/Half-Life_Blue_Shift_box.jpg/450px-Half-Life_Blue_Shift_box.jpg)
2001 video game 2001 video gameHalf-Life: Blue ShiftCover art, depicting the game's protagonist, Barney CalhounDeveloper(s)Gearbox SoftwarePublisher(s)Sierra On-LineValve (digital)Director(s)Randy PitchfordProducer(s)Randy PitchfordDesigner(s)Rob HeironimusProgrammer(s)Sean CavanaughPatrick DeupreeArtist(s)Brian MartelWriter(s)Rob HeironimusDavid MertzRandall S. Pitchford IIComposer(s)Stephen BahlChris JensenSeriesHalf-LifeEngineGoldSrcPlatform(s)Windows, OS X, LinuxReleaseWindowsNA: June 12, 20…
![A Love to Kill](http://upload.wikimedia.org/wikipedia/id/thumb/6/60/A_Love_to_Kill-poster.jpg/450px-A_Love_to_Kill-poster.jpg)
A Love to KillPoster promosi untuk A Love to KillGenreMelodrama RomansaDitulis olehLee Kyung-heeSutradaraKim Kyu-taePemeranRainShin Min-ahKim Sa-rangLee Ki-wooPenggubah lagu temaChoi Sung-kwonNegara asalKorea SelatanBahasa asliKoreaJmlh. episode16ProduksiProduserJung Sung-hyoDurasi60 menit pada hari Senin dan Selasa pukul 21:55RilisRilis asli31 Oktober (2005-10-31) –20 Desember 2005 (2005-12-20)Pranala luarSitus web Nama KoreaHangul이 죽일 놈의 사랑 Alih AksaraI juk-il no…
![Kerala Congress (B)](http://upload.wikimedia.org/wikipedia/commons/thumb/a/a0/Kerala-Congress-flag.svg/450px-Kerala-Congress-flag.svg.png)
For other uses, see Kerala Congress (disambiguation). Indian political party Political party in India Kerala Congress B AbbreviationKEC (B)ChairpersonK. B. Ganesh Kumar (official) Usha Mohandas (splinter group)FounderR. Balakrishna PillaiFounded1977; 46 years ago (1977)Split fromKerala CongressHeadquartersP. T. Chacko Smaraka Mandiram, S. S. Kovil Road, Thampanoor, Thiruvananthapuram-695001, KeralaECI StatusRegistered-UnrecognizedAllianceLDF (1977 – 1982, 2015 – pr…
![Andhra Ikshvaku](http://upload.wikimedia.org/wikipedia/commons/thumb/d/d1/Nagarjunakonda_Ayaka_pillar_inscription_of_the_time_of_Vira-Purushadatta.jpg/450px-Nagarjunakonda_Ayaka_pillar_inscription_of_the_time_of_Vira-Purushadatta.jpg)
Indian dynasty (c. 225 – c.340) For other uses, see Ikshvaku (disambiguation). Ikshvakus of VijayapuriEarly 3rd century–early 4th centurySouth Asia350 CEYAUDHEYASARJUNAYANASMADRAKASMALAVASIKSHVAKUSKALABHRASWESTERNGANGASTOCHARIANSKADAMBASPALLAVASLITTLEKUSHANSLICCHAVISWESTERNSATRAPSSASANIANHINDMAHAMEGHA-VAHANASKAMARUPAGAUDASAMATATASDAVAKAKIDARITESABHIRASVAKATAKASGUPTAEMPIREKUSHANO-SASANIANSSAKASTANTURANMAKRANSASANIANEMPIRE ◁ ▷ Location of the Andhra Ikshvakus in c. 350 CECapitalVijay…