Share to: share facebook share twitter share wa share telegram print page

TAAR5

TAAR5
Ідентифікатори
Символи TAAR5, PNR, trace amine associated receptor 5, taR-5
Зовнішні ІД OMIM: 607405 MGI: 2685073 HomoloGene: 20850 GeneCards: TAAR5
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003967
NM_001389527
NM_001009574
RefSeq (білок)
NP_003958
NP_001009574
Локус (UCSC) Хр. 6: 132.59 – 132.59 Mb Хр. 10: 23.85 – 23.85 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAAR5 (англ. Trace amine associated receptor 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 337 амінокислот, а молекулярна маса — 38 242[4].

Послідовність амінокислот
1020304050
MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVL
GNVFVAFAVSYFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCW
FFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRV
ALRYILAGWGVPAAYTSLFLYTDVVETRLSQWLEEMPCVGSCQLLLNKFW
GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA
AKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC
NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:30236 (англ.) . Процитовано 6 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, O14804 (англ.) . Архів оригіналу за 27 вересня 2017. Процитовано 6 вересня 2017.

Див. також

Read other articles:

Mexican professional wrestler Felino Jr.Born (1987-02-12) February 12, 1987 (age 36)Mexico City, Mexico[1]FamilyCasasProfessional wrestling careerRing name(s)Felino Jr.Kid TigerTiger Kid/Kidd[2]Tiger[2]Billed height1.78 m (5 ft 10 in)[3]Billed weight79 kg (174 lb)[3]Trained byEl Hijo del Gladiador[3]Franco Columbo[3]Satánico[3]Ringo Mendoza[3]El Felino[1]Negro Casas[1]Virus&#...

 

Wappen Deutschlandkarte 52.6166666666678.599722222222237Koordinaten: 52° 37′ N, 8° 36′ O Basisdaten Bundesland: Niedersachsen Landkreis: Diepholz Samtgemeinde: Rehden Höhe: 37 m ü. NHN Fläche: 26,04 km2 Einwohner: 1091 (31. Dez. 2022)[1] Bevölkerungsdichte: 42 Einwohner je km2 Postleitzahl: 49453 Vorwahl: 05448 Kfz-Kennzeichen: DH, SY Gemeindeschlüssel: 03 2 51 006 LOCODE: DE BW5 Adresse der Verbandsverwal...

 

Isabel de Dinamarca Electora consorte de Brandeburgo Ejercicio 10 de abril de 1502-11 de julio de 1535Predecesor Margarita de SajoniaSucesor Eduviges JagellónInformación personalNacimiento 24 de junio de 1485 Castillo de Nyborg, Nyborg, Reino de DinamarcaFallecimiento 10 de junio de 1555 (69 años)Berlín, Margraviato de BrandeburgoSepultura Catedral de BerlínReligión ProtestantismoFamiliaCasa real OldemburgoPadre Juan I de DinamarcaMadre Cristina de SajoniaCónyuge Joaquín I Néstor de ...

José Luis Rodríguez Rodríguez en el Festival de Las Condes 2020Información personalNombre de nacimiento José Luis Rodríguez GonzálezNacimiento 14 de enero de 1943 (80 años)Caracas, VenezuelaNacionalidad VenezolanaEspañolaLengua materna Español FamiliaCónyuge Lila Morillo (matr. 1966; div. 1986)Carolina Pérez (matr. 1996)Hijos Liliana Rodríguez Lilibeth Rodríguez Génesis RodríguezInformación profesionalOcupación cantante, actor, presentador...

 

فاميلي غاي من اليمين: ميغ، كريس، ستوي، بيتر، لويس، وبراين النوع رسوم متحركةكوميديا الموضوع عائلة مختلة  تأليف سيث ماكفارلن إخراج سيث ماكفارلنديفيد زوكرمان بطولة سيث ماكفارلنآليكس بورستينسيث قرينميلا كونيسمايك هنري البلد الولايات المتحدة[1]  لغة العمل الإنجليزي...

 

Polish-Jewish realist painter Maurycy GottliebSelf-portrait, 1876Born21/28 February 1856Drohobycz, Austrian PolandDied17 July 1879(1879-07-17) (aged 23)Kraków, Austrian PolandNationalityPolishEducationAcademies in Kraków, Vienna and MunichKnown forJews Praying in the Synagogue on Yom Kippur, 1878MovementRealism Maurycy Gottlieb (Polish pronunciationⓘ; 21/28 February 1856 – 17 July 1879)[1] was a Polish realist painter of the Romantic period.[2] Considered one o...

Valle de Tabladillo municipio de España Valle de TabladilloUbicación de Valle de Tabladillo en España. Valle de TabladilloUbicación de Valle de Tabladillo en la provincia de Segovia.País  España• Com. autónoma  Castilla y León• Provincia  Segovia• Comarca Comunidad de Villa y Tierra de Sepúlveda• Partido judicial Partido de Sepúlveda• Mancomunidad Municipios de La PedrizaUbicación 41°21′47″N 3°50�...

 

Jukebox musical by Alan Janes featuring the music of Buddy Holly Buddy:The Buddy Holly StoryMusicBuddy Holly and othersLyricsBuddy Holly and othersBookAlan JanesProductions1989–2008 West End 1990–1991 Broadway 1991–2016 UK Tours 1991–2016 US National Tours International productions 2007–2008 West End Revival Buddy: The Buddy Holly Story is a musical in two acts written by Alan Janes, and featuring the music of Buddy Holly. It opened at London's Victoria Palace Theatre on 12 October ...

 

Der Titel dieses Artikels ist mehrdeutig. Zur Vorstadt von St. Veit an der Glan Sankt Veit an der Glan#Villacher Vorstadt. 8. Klagenfurter Bezirk Villacher Vorstadt Fläche 2,03 km² Geografische Lage 46° 37′ N, 14° 18′ O46.62497888888914.308141111111445Koordinaten: 46° 37′ N, 14° 18′ O Höhe 445 m ü. A. Einwohner 8458 (1. Jänner 2023[1]) 4167 Einwohner je km² Postleitzahl 9020, 9010 Karte der Bezirke von ...

Reservoir in Tuolumne County, CaliforniaDon Pedro ReservoirReservoir and Sierra Nevada foothillsDon Pedro ReservoirShow map of CaliforniaDon Pedro ReservoirShow map of the United StatesLocationTuolumne County, CaliforniaCoordinates37°44′29″N 120°22′25″W / 37.7415°N 120.3735°W / 37.7415; -120.3735TypeReservoirPrimary inflowsTuolumne RiverPrimary outflowsTuolumne RiverCatchment area1,500 sq mi (3,900 km2)Basin countriesUnited StatesSurface...

 

2013 studio album by All Pigs Must DieNothing Violates This NatureStudio album by All Pigs Must DieReleased28 June 2013[1]Recorded2013StudioGodcity StudiosGenre Metalcore grindcore crust punk Length33:01LabelSouthern Lord[1]ProducerKurt Ballou[1]All Pigs Must Die chronology God Is War(2011) Nothing Violates This Nature(2013) Professional ratingsAggregate scoresSourceRatingMetacritic82/100[2]Review scoresSourceRatingAllmusic[3]Consequence of Soun...

 

Japanese TV series or program Kamen Rider GaimGenreTokusatsuSuperhero fictionSlapstickScience fictionAction adventureBiopunkDark fantasyBased onKamen Rider conceptby Shotaro IshinomoriDeveloped byNitroplusWritten byGen UrobuchiToriko NanajoGun SnarkNobuhiro MouriJin HaganeyaNorimitsu KaihōDirected byRyuta TasakiTakayuki ShibasakiSatoshi MorotaShojiro NakazawaHidenori IshidaOsamu KanedaKyohei YamaguchiStarringGaku SanoYutaka KobayashiMahiro TakasugiYuumi ShidaYuki KubotaTsunenori AokiMin...

Constituency of the Andhra Pradesh Legislative Assembly, India TuniConstituency for the Andhra Pradesh Legislative AssemblyLocation of Tuni Assembly constituency within Andhra PradeshConstituency detailsCountryIndiaRegionSouth IndiaStateAndhra PradeshDistrictKakinadaLS constituencyKakinadaEstablished1951Total electors212,900ReservationNoneMember of Legislative Assembly15th Andhra Pradesh Legislative AssemblyIncumbent Dadisetti Raja PartyYSR Congress PartyElected year2019 Tuni Assembly constit...

 

The South German Customs Union on a map of 1872 The South German Customs Union (German: Süddeutscher Zollverein) was an attempt by various states in the German Confederation to create a unified customs area, in the early stages of German unification. After several failed attempts to bring in other states, a customs treaty was agreed between the Kingdom of Bavaria and the Kingdom of Württemberg in 1828. It was incorporated into the Prussian-led Zollverein in 1834. First negotiation in 1820 O...

 

Health mission of the government of India Mission IndradhanushCountryIndiaPrime Minister(s)Narendra ModiMinistryMinistry of Health and Family WelfareKey people J. P. Nadda Dr. Harsh Vardhan Launched25 December 2014 (2014-12-25)StatusActiveWebsitenhp.gov.in Mission Indradhanush is a health mission of the Government of India. It was launched by Union Health Minister J. P. Nadda on 25 December 2014.[1] The scheme this seeks to drive towards 90% full immunisation coverage o...

Volvo B5252S merupakan contoh mesin 5 silinder segaris. Mesin 5 silinder segaris atau 5 segaris adalah sebuah mesin pembakaran dalam dengan 5 silinder yang terpasang sejajar dan menggunakan 1 blok mesin dan 1 bak mesin. Konfigurasi mesin ini merupakan pilihan lain dari mesin di bawahnya (4 segaris) atau mesin di atasnya (6 segaris). Dilihat dari sejarahnya, mesin 5 silinder segaris termasuk mesin yang jarang dipakai oleh para pabrikan kendaraan. Meskipun begitu, sejak awal kemunculannya mesin...

 

Monorail station in Bangkok, Thailand Kalantanกลันตัน MRT General informationLocationSuan Luang District, Bangkok, ThailandCoordinates13°43′31″N 100°38′30″E / 13.7253°N 100.6418°E / 13.7253; 100.6418Owned byMass Rapid Transit Authority of Thailand (MRTA)Operated byEastern Bangkok Monorail Company Limited (EBM)Line(s)  Yellow LineOther informationStation codeYL12HistoryOpened3 June 2023Services Preceding station Metropolitan...

 

New Zealand long-distance runner Moon in 2021 Melissa Potocka Moon MNZM (born 16 September 1969) is a long-distance runner from Wellington, New Zealand. She is a two time World Mountain Running champion and has won 21 New Zealand athletics titles over her career. In 2001, she was named New Zealand Sportswoman of the Year. In 2008, she was named as one of the JCI Ten Outstanding Young Persons of the World (TOYP).[1] In 2010, Moon won the women's race up the 86 flights of stairs of the ...

For the Pnau song, see Into the Sky (Pnau song). 2005 studio album by g.o.dInto the SkyStudio album by g.o.dReleasedOctober 28, 2005Recorded2005Genre K-pop R&B Dance pop Length49:19LanguageKoreanLabel JYP Seoul Records Producer Park Jin-young Bang Si-hyuk Kwon Tae-eun Lunchsong Project Seo Eui-beom Hwang In-beom Mad Soul Child Rhee Woo-seok G.o.d chronology An Ordinary Day(2004) Into the Sky(2005) Chapter 8(2014) Singles from Into the Sky Two-LoveReleased: October 28, 2005 Into th...

 

2011 song by Chris Brown Not to be confused with Deuce (song). DeucesSingle by Chris Brown featuring Tyga and Kevin McCallfrom the album Fan of a Fan and F.A.M.E. B-sideNo BullshitReleasedJune 25, 2010 (2010-06-25)Recorded2010StudioIn Your Ear Studios(Richmond, Virginia)GenreR&Bhip hopLength4:36LabelJiveSongwriter(s)Chris BrownMichael StevensonKevin McCallProducer(s)Kevin K-Mac McCallChris Brown singles chronology Back to the Crib (2009) Deuces (2010) Make a Movie (2010...

 
Kembali kehalaman sebelumnya