Share to: share facebook share twitter share wa share telegram print page

PTGDR2

PTGDR2
Ідентифікатори
Символи PTGDR2, CD294, CRTH2, DL1R, DP2, GPR44, prostaglandin D2 receptor 2
Зовнішні ІД OMIM: 604837 MGI: 1330275 HomoloGene: 3508 GeneCards: PTGDR2
Реагує на сполуку
індометацин, prostaglandin D2, prostaglandin E2, prostaglandin F2α, U46619, ramatroban, ramatroban, donitriptan, setipiprant, azd-1981, fevipiprant, qav-680[1]
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004778
NM_009962
RefSeq (білок)
NP_004769
NP_034092
Локус (UCSC) Хр. 11: 60.85 – 60.86 Mb Хр. 19: 10.91 – 10.92 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PTGDR2 (англ. Prostaglandin D2 receptor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 395 амінокислот, а молекулярна маса — 43 268[5].

Послідовність амінокислот
1020304050
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVEN
GVILFVVGCRMRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELG
TTFCKLHSSIFFLNMFASGFLLSAISLDRCLQVVRPVWAQNHRTVAAAHK
VCLVLWALAVLNTVPYFVFRDTISRLDGRIMCYYNVLLLNPGPDRDATCN
SRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRRPGRFVRLVAA
VVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARS
ASPLALCSRPEEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Локалізований у клітинній мембрані, мембрані.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Monneret G., Gravel S., Diamond M., Rokach J., Powell W.S. (2001). Prostaglandin D2 is a potent chemoattractant for human eosinophils that acts via a novel DP receptor. Blood. 98: 1942—1948. PMID 11535533 DOI:10.1182/blood.V98.6.1942
  • Xue L., Gyles S.L., Barrow A., Pettipher R. (2007). Inhibition of PI3K and calcineurin suppresses chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2)-dependent responses of Th2 lymphocytes to prostaglandin D(2). Biochem. Pharmacol. 73: 843—853. PMID 17196174 DOI:10.1016/j.bcp.2006.11.021

Примітки

  1. Сполуки, які фізично взаємодіють з Prostaglandin D2 receptor 2 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:4502 (англ.) . Процитовано 8 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, Q9Y5Y4 (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 8 вересня 2017.

Див. також


Read other articles:

San Alejandro de Alejandría Información personalNombre en griego antiguo Αλέξανδρος Α' Nacimiento 250 d. C.AlejandríaFallecimiento 326 d. C.AlejandríaReligión CristianismoInformación profesionalOcupación Presbítero Área Ministerio eclesiástico y apologética Cargos ocupados Patriarca de Alejandría (313-326) Información religiosaFestividad 26 de febreroVenerado en Iglesia copta, Iglesia ortodoxa, Iglesia católicaSantuario templo de Bucalis   ...

 

Центр Картера Дата створення / заснування 1982 Спонсор Національний фонд на підтримку демократії[1] Названо на честь Джиммі Картер Засновник Джиммі Картер і Розалін Картер Країна  США Організаційно-правова форма організація 501(c)(3)d[2] Загальна виручка ▼127...

 

Religion by country Africa Algeria Angola Benin Botswana Burkina Faso Burundi Cameroon Cape Verde Central African Republic Chad Comoros Democratic Republic of the Congo Republic of the Congo Djibouti Egypt Equatorial Guinea Eritrea Eswatini Ethiopia Gabon Gambia Ghana Guinea Guinea-Bissau Ivory Coast Kenya Lesotho Liberia Libya Madagascar Malawi Mali Mauritania Mauritius Morocco Mozambique Namibia Niger Nigeria Rwanda São Tomé and Príncipe Senegal Seychelles Sierra Leone Somalia South Afri...

Tamara Lazakóvich Datos personalesNacimiento Gusevo, Kaliningrad Oblast (Rusia)11 de marzo de 1954Nacionalidad(es) RusaFallecimiento Vítebsk (Bielorrusia)1 de noviembre de 1992Carrera deportivaDeporte Gimnasia artística               Medallero  Unión Soviética Gimnasia artística Juegos Olímpicos OroMúnich 1972Equipo PlataMúnich 1972Barra BronceMúnich 1972General individual BronceMúnich 1972Suelo Campeonato M...

 

Online digital book library For other uses, see Project Gutenberg (disambiguation). Project GutenbergEstablishedDecember 1971; 52 years ago (1971-12)(first document posted)[1]CollectionSizeOver 70,000 documentsOther informationWebsitegutenberg.org Project Gutenberg (PG) is a volunteer effort to digitize and archive cultural works, as well as to encourage the creation and distribution of eBooks.[2] It was founded in 1971 by American writer Michael S. Hart...

 

Perayap-kayu Dendrocolaptidae Cocoa Woodcreeper (en) TaksonomiKerajaanAnimaliaFilumChordataKelasAvesOrdoPasseriformesUpaordoTyranniFamiliDendrocolaptidae lbs Perayap-kayu ( Dendrocolaptinae ) terdiri dari subfamili burung pengicau suboscine yang endemik di Neotropik . Mereka secara tradisional dianggap sebagai keluarga yang berbeda Dendrocolaptidae, namun sebagian besar pihak berwenang sekarang menempatkan mereka sebagai subfamili dari burung oven (Furnariidae). Mereka sekilas mirip dengan pe...

Minyak alpukat Minyak alpukat adalah minyak nabati yang ditekan dari buah alpukat. Sebagai minyak makanan, digunakan sebagai bahan dalam hidangan lainnya, dan sebagai minyak goreng. Ini juga digunakan untuk pelumasan dan kosmetik, di mana ia dihargai karena sifat regeneratif dan pelembabnya.[1] Minyak itu ditekan dari bubur berdaging yang mengelilingi lubang alpukat dan bukan lubang itu sendiri. Ia memiliki titik asap yang luar biasa tinggi: 250 °C (482 °F) untuk minyak me...

 

2001 film by Kishore Sarja Baava BaamaidaTheatrical release posterDirected byKishore SarjaWritten byManoj KumarProduced byRamuStarringShiva Rajkumar Rambha Prakash RaiCinematographyAshok KashyapEdited byS. ManoharMusic byHamsalekhaProductioncompanyRamu EnterprisesRelease date 23 August 2001 (2001-08-23) Running time161 minCountryIndiaLanguageKannada Baava Baamaida is a 2001 Indian Kannada-language romantic comedy film starring Shiva Rajkumar and Rambha. The film is directed by ...

 

K. H.Hisjam bin HoesniKetua Umum Muhammadiyah ke-3Masa jabatan1934 – 1936PendahuluK. H. Ibrahim bin FadlilPenggantiK. H. Mas Mansoer Informasi pribadiLahir10 November 1883Ngayogyakarta, Hindia BelandaMeninggal20 Mei 1945(1945-05-20) (umur 61)Ngayogyakarta, Hindia BelandaSunting kotak info • L • B K. H. Hisjam bin Hoesni (ER, EYD: Hisyam bin Husni; 10 November 1883 – 20 Mei 1945) adalah Ketua Pengurus Besar Muhammadiyah yang ketiga. Ia memimpin...

Village in Maharashtra This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Patole – news · newspapers · books · scholar · JSTOR (November 2012) (Learn how and when to remove this template message) Village in Maharashtra, IndiaPatolevillagePatoleLocation in Maharashtra, IndiaCoordinates: 19°47′07″N 73°59′...

 

American reality television series This article is about the American series. For the Shark Tank TV franchise, see Dragons' Den. For the Indian series, see Shark Tank India. For the arena in California, see SAP Center. Shark TankGenreReality televisionCreated byMark BurnettDirected byCraig SpirkoKen FuchsAlan CarterStarring Kevin O'Leary Mark Cuban Robert Herjavec Lori Greiner Daymond John Barbara Corcoran Kevin Harrington Narrated byPhil CrowleyComposers Jeff Lippencott Mark T. Williams Coun...

 

Award given by the Walt Disney Company 34°9′29.65″N 118°19′35″W / 34.1582361°N 118.32639°W / 34.1582361; -118.32639 The Disney Legends Awards is a Hall of Fame program that recognizes individuals who have made an extraordinary and integral contribution to The Walt Disney Company. Established in 1987, the honor was traditionally awarded annually during a special private ceremony. Since 2009, it has been awarded biannually during Disney's D23 Expo.[1]...

1933 song by Peter DeRose Deep PurpleComposition by Peter DeRosePublished1933Composer(s)Peter DeRoseLyricist(s)Mitchell Parish (added 1938) Deep Purple is a song and the biggest hit written by pianist Peter DeRose, who broadcast between 1923 and 1939 with May Singhi as The Sweethearts of the Air on the NBC radio network. The British rock band Deep Purple named themselves after the song. Origin Deep Purple was published in 1933 as a piano composition. The following year, Paul Whiteman had it s...

 

Fictional character from Coronation Street For other people named Alan Bradley, see Alan Bradley (disambiguation). Soap opera character Alan BradleyCoronation Street characterPortrayed byMark EdenDuration1986–1989First appearanceEpisode 258715 January 1986Last appearanceEpisode 30028 December 1989ClassificationFormer; regularIntroduced byJohn G. TempleIn-universe informationOccupationBusinessmanWifePat Bradley (backstory)DaughtersJenny BradleyGrandsonsTom Midgeley Alan B...

 

Indian crime fiction-detective TV series This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.Find sources: Private Investigator TV series – news · newspapers · books · scholar · JSTOR (September 2022) Private InvestigatorAlso known asP.I Private InvestigatorGenreCrime fictionDramaPolice proceduralComedyStarring...

NJ Transit rail station SecaucusUpper level platforms of Secaucus JunctionGeneral informationOther namesFrank R. Lautenberg Rail Station at Secaucus JunctionLocationCounty Road & County AvenueSecaucus, New JerseyCoordinates40°45′41″N 74°04′32″W / 40.76127917328393°N 74.07569111593966°W / 40.76127917328393; -74.07569111593966Owned byNew Jersey TransitLine(s) Amtrak Northeast Corridor All NJT lines (except for Atlantic City Line) Metro-North Railroad Port...

 

Itazura na KissイタズラなKiss(Itazura na Kiss)GenreRomansa[1] MangaPengarangKaoru TadaPenerbitShueishaPenerbit bahasa InggrisNA Digital Manga PublishingMajalahBessatsu MargaretDemografiShōjoTerbitJuni 1990 – Maret 1999Volume23 Drama televisiSutradaraMorita Mitsunori, Nemoto Minoki, Ikezoe HiroshiProduserMorita Mitsunori, Sato Ryoichi, Uchiyama SeikoSkenarioKusumoto Hiromi, Mori HarumiMusikNakamura YukiyoSaluranasliTV AsahiTayang 14 Oktober 1996 – 16 Desember 1996Episode9 Ser...

 

Dewan Perwakilan Rakyat Daerah Kabupaten JeparaDewan Perwakilan RakyatKabupaten Jepara2019-2024JenisJenisUnikameral Jangka waktu5 tahunSejarahSesi baru dimulai13 Agustus 2019PimpinanKetuaHaizul Ma'arif, S.H. (PPP) sejak 12 November 2020 Wakil Ketua IDrs. H. Junarso (PDI-P) sejak 8 Oktober 2019 Wakil Ketua IIH. Pratikno (NasDem) sejak 8 Oktober 2019 Wakil Ketua IIIK.H. Nuruddin Amin, S.Ag. (PKB) sejak 8 Oktober 2019 KomposisiAnggota50Partai & kursi  PDI-P (8) ...

American racing driver Robbie BuhlBuhl at the 1997 Indianapolis 500NationalityAmericanBorn (1963-09-02) September 2, 1963 (age 60)Detroit, Michigan, U.S.Retired2004Indy Racing League IndyCar SeriesYears active1996–2004TeamsBeck MotorsportsTeam MenardSinden RacingTri-Star RacingDreyer & Reinbold RacingStarts78Wins2Poles0Best finish3rd in 1996Previous series1993–19941990–19961989CART World SeriesIndy LightsBarber Saab Pro SeriesChampionship titles19921989Indy LightsBarber Saab Pr...

 

Ottoman pasha Kabuli MehmedPashaBorn1812Constantinople, Ottoman EmpireDied1877 (aged 64–65)ConstantinopleNationalityOttomanOccupation(s)Politician, government minister. Kabuli Mehmed Pasha (1812 – 1877) was an Ottoman liberal politician and government minister.[1][2] References ^ Mehmed Kabuli Pşa. ^ Serif Mardin (1962). Genesis of Young Ottoman Thought. Princeton University Press. ISBN 978-0-691-65530-7. This Ottoman biographical article is a stub. You can ...

 
Kembali kehalaman sebelumnya